SimulationCraft 902-01

for World of Warcraft 9.0.2.36753 Live (wow build level 36753)

Beta Release

Current simulator hotfixes

Death Knight

Tag Spell / Effect Field Hotfixed Value DBC Value
2020-10-25 Incorrect cooldown for Magus of the Dead's Frostbolt.
Frostbolt cooldown 3000.00 0.00
2020-09-20 Incorrect cooldown for Magus of the Dead's Frostbolt.
Frostbolt cooldown 3000.00 0.00

Mage

Tag Spell / Effect Field Hotfixed Value DBC Value
2018-12-28 Manually set Arcane Orb's travel speed.
Arcane Orb prj_speed 20.00 0.00
2017-06-21 Ice Lance is slower than spell data suggests.
Ice Lance prj_speed 47.00 50.00
2017-03-20 Manually set Frozen Orb's travel speed.
Frozen Orb prj_speed 20.00 0.00

Monk

Tag Spell / Effect Field Hotfixed Value DBC Value
2020-11-21 Manually set Periodic Damage Windwalker Monk Two-Hand Adjustment by 2%
Windwalker Monk Two-Hand Adjustment (effect#2) base_value 2.00 0.00
2020-11-21 Manually set Direct Damage Windwalker Monk Two-Hand Adjustment by 2%
Windwalker Monk Two-Hand Adjustment (effect#1) base_value 2.00 0.00

Warlock

Tag Spell / Effect Field Hotfixed Value DBC Value
2020-11-15 Manually set secondary Malefic Rapture level requirement
Malefic Rapture spell_level 11.00 43.00

Table of Contents

Raid Summary

Additional Raid Information

call_ot_wild : 10915 dps, 3767 dps to main target

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
10914.5 10914.5 16.3 / 0.149% 1104.2 / 10.1% 1045.8
RPS Out RPS In Primary Resource Waiting APM Active Skill
10.4 10.2 Focus 0.00% 47.8 100.0% 100%
Talents
Night Fae
Runeforge

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
call_ot_wild 10915
Aimed Shot 3856 (4239) 35.4% (38.9%) 50.1 5.92sec 25339 16909 Direct 250.4 (274.3) 3760 7552 4618 22.6% (22.7%)

Stats Details: Aimed Shot

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 50.14 250.40 0.00 0.00 1.4985 0.0000 1156465.63 1651895.50 29.99% 16909.10 16909.10
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 77.35% 193.69 139 252 3759.59 2524 9967 3759.43 3469 3976 728210 1040175 29.99%
crit 22.65% 56.71 31 85 7551.51 5048 19934 7549.98 6265 8900 428255 611720 29.99%

Action Details: Aimed Shot

  • id:19434
  • school:physical
  • range:40.0
  • travel_speed:100.0000
  • radius:8.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:12.000
  • cooldown hasted:true
  • base_recharge_multiplier:1.000
  • base_execute_time:2.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:focus
  • base_cost:35.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:19434
  • name:Aimed Shot
  • school:physical
  • tooltip:
  • description:A powerful aimed shot that deals {$s1=0} Physical damage.

Action Priority List

    trickshots
    [J]:50.31
  • if_expr:buff.trick_shots.remains>=execute_time&(buff.precise_shots.down|full_recharge_time<cast_time+gcd|buff.trueshot.up)
  • target_if_expr:(dot.serpent_sting.remains<?action.serpent_sting.in_flight_to_target*dot.serpent_sting.duration)
    Aimed Shot (_double_tap) 382 3.5% 0.0 0.00sec 0 0 Direct 23.9 3873 7754 4776 23.3%

Stats Details: Aimed Shot Double Tap

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 0.00 23.88 0.00 0.00 0.0000 0.0000 114050.48 162909.71 29.99% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 76.75% 18.33 5 31 3872.56 2524 9967 3892.01 3040 5180 70975 101381 29.99%
crit 23.25% 5.55 0 15 7753.86 5048 19934 7774.44 0 19934 43075 61528 29.89%

Action Details: Aimed Shot Double Tap

  • id:19434
  • school:physical
  • range:40.0
  • travel_speed:100.0000
  • radius:8.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:12.000
  • cooldown hasted:true
  • base_recharge_multiplier:1.000
  • base_execute_time:2.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:focus
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:19434
  • name:Aimed Shot
  • school:physical
  • tooltip:
  • description:A powerful aimed shot that deals {$s1=0} Physical damage.
Auto Shot 370 3.4% 111.8 2.69sec 992 437 Direct 111.6 811 1621 994 22.6%

Stats Details: Auto Shot

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 111.81 111.58 0.00 0.00 2.2695 0.0000 110905.68 158417.67 29.99% 437.06 437.06
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 77.38% 86.35 61 113 810.64 774 1019 810.54 796 826 69995 99981 29.99%
crit 22.62% 25.23 10 45 1621.22 1548 2037 1621.09 1557 1731 40911 58437 29.99%

Action Details: Auto Shot

  • id:75
  • school:physical
  • range:40.0
  • travel_speed:60.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00

Spelldata

  • id:75
  • name:Auto Shot
  • school:physical
  • tooltip:Firing at the target.
  • description:Automatically shoots the target until cancelled.
Dreadfire Vessel 138 1.3% 3.7 90.72sec 11036 0 Direct 3.7 9025 18036 11079 22.8%

Stats Details: Dreadfire Vessel

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 3.74 3.72 0.00 0.00 0.0000 0.0000 41224.49 41224.49 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 77.21% 2.87 0 4 9024.88 8937 9474 8955.76 0 9474 25930 25930 0.00%
crit 22.79% 0.85 0 4 18036.49 17875 18947 10903.83 0 18947 15295 15295 0.00%

Action Details: Dreadfire Vessel

  • id:344732
  • school:fire
  • range:50.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:90.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:8212.26
  • base_dd_max:8212.26
  • base_dd_mult:1.00

Spelldata

  • id:344732
  • name:Dreadfire Vessel
  • school:fire
  • tooltip:
  • description:Unleash incendiary flames at your target inflicting {$s1=0} Fire damage.
Eternal Skirmish 40 0.4% 21.8 13.77sec 548 0 Direct 21.8 446 892 548 22.9%

Stats Details: Eternal Skirmish

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 21.76 21.76 0.00 0.00 0.0000 0.0000 11932.95 11932.95 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 77.05% 16.76 6 31 446.18 435 485 446.15 437 460 7480 7480 0.00%
crit 22.95% 4.99 0 13 891.78 871 969 886.87 0 969 4453 4453 0.00%

Action Details: Eternal Skirmish

  • id:323889
  • school:shadow
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:400.00
  • base_dd_max:400.00
  • base_dd_mult:1.00

Spelldata

  • id:323889
  • name:Eternal Skirmish
  • school:shadow
  • tooltip:
  • description:Deals {$s1=400} Shadow damage.
Kill Shot 81 0.7% 4.5 13.95sec 5427 4539 Direct 4.4 4261 9561 5463 22.7%

Stats Details: Kill Shot

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 4.48 4.45 0.00 0.00 1.1957 0.0000 24293.87 34701.37 29.99% 4539.21 4539.21
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 77.31% 3.44 0 6 4260.59 4065 5095 4235.31 0 4810 14645 20919 29.89%
crit 22.69% 1.01 0 4 9560.92 9146 11464 6422.20 0 11464 9649 13782 20.18%

Action Details: Kill Shot

  • id:53351
  • school:physical
  • range:40.0
  • travel_speed:80.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:10.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:focus
  • base_cost:10.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:53351
  • name:Kill Shot
  • school:physical
  • tooltip:
  • description:You attempt to finish off a wounded target, dealing {$s1=0} Physical damage. Only usable on enemies with less than {$s2=20}% health.

Action Priority List

    trickshots
    [M]:4.47
  • if_expr:buff.dead_eye.down
Master Marksman 498 4.6% 312.8 0.98sec 477 0 Periodic 528.1 283 0 283 0.0% 70.4%

Stats Details: Master Marksman

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 312.84 0.00 528.12 528.12 0.0000 2.0000 149366.08 149366.08 0.00% 141.41 0.00
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 100.00% 528.12 382 685 282.79 37 2621 282.79 228 330 149366 149366 0.00%

Action Details: Master Marksman

  • id:269576
  • school:physical
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:false
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:6.00
  • base_tick_time:2.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH

Spelldata

  • id:269576
  • name:Master Marksman
  • school:physical
  • tooltip:Bleeding for $w1 damage every $t1 sec.
  • description:{$@spelldesc260309=Your ranged special attack critical strikes cause the target to bleed for an additional {$s1=15}% of the damage dealt over {$269576d=6 seconds}.}
Multi-Shot 2715 24.9% 81.2 3.68sec 10026 8783 Direct 405.0 1638 3279 2010 22.7%

Stats Details: Multishot

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 81.20 404.96 0.00 0.00 1.1415 0.0000 814111.26 1162876.53 29.99% 8782.88 8782.88
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 77.34% 313.20 236 391 1638.21 953 2194 1638.17 1537 1718 513182 733029 29.99%
crit 22.66% 91.77 52 137 3278.87 1905 4389 3278.42 2998 3487 300930 429848 29.99%

Action Details: Multishot

  • id:257620
  • school:physical
  • range:40.0
  • travel_speed:50.0000
  • radius:10.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:5
  • harmful:true

Resources

  • resource:focus
  • base_cost:20.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:257620
  • name:Multi-Shot
  • school:physical
  • tooltip:
  • description:Fires several missiles, hitting your current target and up to $I enemies within $A1 yards for {$s1=0} Physical damage.

Action Priority List

    trickshots
    [L]:76.22
  • if_expr:buff.trick_shots.down|buff.precise_shots.up&focus>cost+action.aimed_shot.cost&(!talent.chimaera_shot|active_enemies>3)
    trickshots
    [N]:4.98
  • if_expr:focus>cost+action.aimed_shot.cost
Rapid Fire 1143 10.5% 17.4 17.35sec 19652 11159 Periodic 632.6 442 884 542 22.6% 1.8%

Stats Details: Rapid Fire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 17.45 0.00 127.03 632.65 1.7611 0.2072 342907.85 489809.58 29.99% 11159.46 11159.46
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 77.38% 489.54 294 666 441.98 351 925 441.82 430 457 216367 309058 29.99%
crit 22.62% 143.10 82 209 884.15 703 1850 884.22 798 956 126541 180751 29.99%

Action Details: Rapid Fire

  • id:257044
  • school:physical
  • range:40.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:20.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:false
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:2.00
  • base_tick_time:0.33
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH

Spelldata

  • id:257044
  • name:Rapid Fire
  • school:physical
  • tooltip:Being targeted by Rapid Fire.
  • description:Shoot a stream of {$s1=7} shots at your target over {$d=2 seconds}, dealing a total of ${$m1*$257045sw1} Physical damage. {$?s321281=true}[ Each shot generates {$263585s1=1} Focus.][] Usable while moving.

Action Details: Rapid Fire Damage

  • id:257045
  • school:physical
  • range:40.0
  • travel_speed:40.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:on_hit
  • energize_resource:focus
  • energize_amount:1.0

Spelldata

  • id:257045
  • name:Rapid Fire
  • school:physical
  • tooltip:
  • description:{$@spelldesc257044=Shoot a stream of {$s1=7} shots at your target over {$d=2 seconds}, dealing a total of ${$m1*$257045sw1} Physical damage. {$?s321281=true}[ Each shot generates {$263585s1=1} Focus.][] Usable while moving.}

Action Priority List

    trickshots
    [K]:17.45
  • if_expr:buff.trick_shots.remains>=execute_time
Shadowcore Oil Blast 44 0.4% 43.7 6.76sec 301 0 Direct 43.7 245 491 301 22.7%

Stats Details: Shadowcore Oil Blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 43.69 43.69 0.00 0.00 0.0000 0.0000 13155.24 13155.24 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 77.31% 33.78 15 60 245.42 239 266 245.44 241 250 8290 8290 0.00%
crit 22.69% 9.91 2 21 490.79 479 533 490.80 479 516 4865 4865 0.00%

Action Details: Shadowcore Oil Blast

  • id:336463
  • school:shadow
  • range:60.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:220.00
  • base_dd_max:220.00
  • base_dd_mult:1.00

Spelldata

  • id:336463
  • name:Shadowcore Oil Blast
  • school:shadow
  • tooltip:
  • description:Deals {$s1=220} Shadow damage.
Steady Shot 338 3.1% 64.3 4.64sec 1574 1168 Direct 65.2 1266 2531 1552 22.6%

Stats Details: Steady Shot

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 64.31 65.22 0.00 0.00 1.3471 0.0000 101219.44 144581.84 29.99% 1168.30 1168.30
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 77.42% 50.49 33 71 1266.47 1219 1605 1266.28 1236 1297 63949 91345 29.99%
crit 22.58% 14.72 2 29 2531.36 2439 3210 2531.17 2439 2734 37270 53237 29.99%

Action Details: Steady Shot

  • id:56641
  • school:physical
  • range:40.0
  • travel_speed:75.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:1.75
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:on_cast
  • energize_resource:focus
  • energize_amount:10.0

Spelldata

  • id:56641
  • name:Steady Shot
  • school:physical
  • tooltip:
  • description:A steady shot that causes {$s1=0} Physical damage. Usable while moving.{$?s321018=true}[ |cFFFFFFFFGenerates {$s2=0} Focus.][]

Action Priority List

    trickshots
    [F]:16.66
  • if_expr:talent.steady_focus&in_flight&buff.steady_focus.remains<5
    trickshots
    [O]:47.92
Wild Spirits 47 (1310) 0.4% (11.9%) 3.0 120.61sec 130902 119162 Direct 14.8 (224.4) 774 1545 948 22.5% (22.7%)

Stats Details: Wild Spirits

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.98 14.84 0.00 0.00 1.0987 0.0000 14066.03 14066.03 0.00% 119162.03 119162.03
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 77.53% 11.51 4 15 774.37 726 910 774.60 726 833 8912 8912 0.00%
crit 22.47% 3.34 0 9 1545.36 1452 1820 1499.04 0 1751 5154 5154 0.00%

Action Details: Wild Spirits

  • id:328231
  • school:nature
  • range:40.0
  • travel_speed:30.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:120.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:328231
  • name:Wild Spirits
  • school:nature
  • tooltip:
  • description:Evoke the energy of Wild Spirits at the target location, dealing {$328837s3=0} Nature damage and apply Hunter's Mark to all enemy targets within the area for {$328837d=15 seconds}. While the Wild Spirits are active, each damaging ability you or your pet use against a target in the area will strike up to $328757I nearby targets for {$328757s1=0} Nature damage.

Action Details: Wild Spirits Damage

  • id:328837
  • school:nature
  • range:100.0
  • travel_speed:0.0000
  • radius:12.0
  • trigger_gcd:0.0000
  • gcd_type:attack_haste
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:328837
  • name:Wild Spirits
  • school:nature
  • tooltip:
  • description:{$@spelldesc328231=Evoke the energy of Wild Spirits at the target location, dealing {$328837s3=0} Nature damage and apply Hunter's Mark to all enemy targets within the area for {$328837d=15 seconds}. While the Wild Spirits are active, each damaging ability you or your pet use against a target in the area will strike up to $328757I nearby targets for {$328757s1=0} Nature damage.}

Action Priority List

    trickshots
    [H]:2.98
    Wild Spirits (_proc) 1263 11.5% 41.9 6.17sec 8972 0 Direct 209.5 1462 2923 1794 22.7%

Stats Details: Wild Spirits Proc

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 41.90 209.52 0.00 0.00 0.0000 0.0000 375951.28 375951.28 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 77.26% 161.88 108 191 1461.92 1355 1699 1462.87 1438 1520 236661 236661 0.00%
crit 22.74% 47.64 25 72 2923.44 2711 3398 2925.54 2819 3084 139291 139291 0.00%

Action Details: Wild Spirits Proc

  • id:328757
  • school:nature
  • range:40.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:attack_haste
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:5
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:328757
  • name:Wild Spirits
  • school:nature
  • tooltip:
  • description:{$@spelldesc328231=Evoke the energy of Wild Spirits at the target location, dealing {$328837s3=0} Nature damage and apply Hunter's Mark to all enemy targets within the area for {$328837d=15 seconds}. While the Wild Spirits are active, each damaging ability you or your pet use against a target in the area will strike up to $328757I nearby targets for {$328757s1=0} Nature damage.}
Simple Action Stats Execute Interval
call_ot_wild
Veiled Augmentation (augmentation) 1.0 0.00sec

Stats Details: Augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Augmentation

  • id:347901
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:call_ot_wild
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Blood Fury 2.7 151.10sec

Stats Details: Blood Fury

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.67 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Blood Fury

  • id:20572
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:120.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:20572
  • name:Blood Fury
  • school:physical
  • tooltip:Attack power increased by $w1.
  • description:Increases your attack power by {$s1=122} for {$d=15 seconds}.

Action Priority List

    cds
    [D]:2.67
  • if_expr:buff.trueshot.up|target.time_to_die<16
Double Tap 5.6 60.65sec

Stats Details: Double Tap

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 5.60 0.00 0.00 0.00 0.9776 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Double Tap

  • id:260402
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:60.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:260402
  • name:Double Tap
  • school:physical
  • tooltip:Your next Aimed Shot will fire a second time instantly at {$s4=100}% power and consume no Focus, or your next Rapid Fire will shoot {$s3=100}% additional shots during its channel.
  • description:Your next Aimed Shot will fire a second time instantly at {$s4=100}% power without consuming Focus, or your next Rapid Fire will shoot {$s3=100}% additional shots during its channel.

Action Priority List

    trickshots
    [G]:4.61
  • if_expr:covenant.kyrian&cooldown.resonating_arrow.remains<gcd|cooldown.rapid_fire.remains<cooldown.aimed_shot.full_recharge_time|!(talent.streamline&runeforge.surging_shots)|!covenant.kyrian
Spectral Flask of Power (flask) 1.0 0.00sec

Stats Details: Flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Flask

  • id:307185
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:call_ot_wild
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Feast of Gluttonous Hedonism (food) 1.0 0.00sec

Stats Details: Food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Food

  • id:308462
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:call_ot_wild
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Potion of Spectral Agility (potion) 1.5 307.19sec

Stats Details: Potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.48 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Potion

  • id:307159
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:300.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Action Priority List

    cds
    [E]:1.47
  • if_expr:buff.trueshot.up&buff.bloodlust.up|buff.trueshot.up&target.health.pct<20|target.time_to_die<26
Trueshot 4.4 78.65sec

Stats Details: Trueshot

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 4.37 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Trueshot

  • id:288613
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:attack_haste
  • min_gcd:0.0000
  • cooldown:120.000
  • cooldown hasted:false
  • base_recharge_multiplier:0.650
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:288613
  • name:Trueshot
  • school:physical
  • tooltip:The cooldown of Aimed Shot and Rapid Fire is reduced by ${$m1/4}%, and Aimed Shot casts {$s4=50}% faster. All Focus generation is increased by {$s5=50}%.
  • description:Reduces the cooldown of your Aimed Shot and Rapid Fire by ${$m1/4}%, and causes Aimed Shot to cast {$s4=50}% faster for {$d=15 seconds}. While Trueshot is active, you generate {$s5=50}% additional Focus.

Action Priority List

    trickshots
    [I]:4.37

Buffs

Dynamic Buffs Start Refresh Interval Trigger Avg Dur Up-Time Benefit Overflow Expiry
Blood Fury 2.7 0.0 151.0sec 151.0sec 14.6sec 12.90% 0.00% 0.0 (0.0) 2.5

Buff Details

  • buff initial source:call_ot_wild
  • cooldown name:buff_blood_fury
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:120.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:attack_power
  • amount:122.00

Trigger Details

  • interval_min/max:120.0s / 160.9s
  • trigger_min/max:120.0s / 160.9s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 15.0s

Stack Uptimes

  • blood_fury_1:12.90%

Spelldata

  • id:20572
  • name:Blood Fury
  • tooltip:Attack power increased by $w1.
  • description:Increases your attack power by {$s1=122} for {$d=15 seconds}.
  • max_stacks:0
  • duration:15.00
  • cooldown:120.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 40.0sec 13.52% 0.00% 0.0 (0.0) 1.0

Buff Details

  • buff initial source:call_ot_wild
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • base duration:40.00
  • duration modifier:1.00
  • base cooldown:300.00
  • default_chance:100.00%
  • default_value:0.30
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:40.0s / 40.0s

Stack Uptimes

  • bloodlust_1:13.52%

Spelldata

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by $w1%.
  • description:Increases haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Double Tap 5.6 0.0 58.4sec 60.6sec 4.1sec 7.61% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:call_ot_wild
  • cooldown name:buff_double_tap
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.50
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:50.0s / 62.7s
  • trigger_min/max:60.0s / 62.7s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 11.1s

Stack Uptimes

  • double_tap_1:7.61%

Spelldata

  • id:260402
  • name:Double Tap
  • tooltip:Your next Aimed Shot will fire a second time instantly at {$s4=100}% power and consume no Focus, or your next Rapid Fire will shoot {$s3=100}% additional shots during its channel.
  • description:Your next Aimed Shot will fire a second time instantly at {$s4=100}% power without consuming Focus, or your next Rapid Fire will shoot {$s3=100}% additional shots during its channel.
  • max_stacks:0
  • duration:15.00
  • cooldown:60.00
  • default_chance:0.00%
Well Fed (feast_of_gluttonous_hedonism) 1.0 0.0 0.0sec 0.0sec 300.0sec 100.00% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:call_ot_wild
  • cooldown name:buff_feast_of_gluttonous_hedonism
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:agility
  • amount:20.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:240.1s / 359.8s

Stack Uptimes

  • feast_of_gluttonous_hedonism_1:100.00%

Spelldata

  • id:327709
  • name:Well Fed
  • tooltip:Agility increased by $w1.
  • description:Agility increased by {$s1=20}. Lasts {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Lock and Load 8.6 0.2 31.6sec 30.9sec 1.8sec 5.25% 16.69% 0.2 (0.2) 0.0

Buff Details

  • buff initial source:call_ot_wild
  • cooldown name:buff_lock_and_load
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:8.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:1.8s / 300.5s
  • trigger_min/max:1.8s / 300.5s
  • trigger_pct:7.83%
  • duration_min/max:0.0s / 9.8s

Stack Uptimes

  • lock_and_load_1:5.25%

Spelldata

  • id:194594
  • name:Lock and Load
  • tooltip:Aimed Shot costs no Focus and is instant.
  • description:{$@spelldesc194595=Your ranged auto attacks have a {$194595h=8}% chance to trigger Lock and Load, causing your next Aimed Shot to cost no Focus and be instant.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%

Trigger Spelldata

  • id:194595
  • name:Lock and Load
  • tooltip:
  • description:Your ranged auto attacks have a {$194595h=8}% chance to trigger Lock and Load, causing your next Aimed Shot to cost no Focus and be instant.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:8.00%
Potion of Spectral Agility 1.5 0.0 306.7sec 306.7sec 23.3sec 11.25% 0.00% 0.0 (0.0) 1.2

Buff Details

  • buff initial source:call_ot_wild
  • cooldown name:buff_potion_of_spectral_agility
  • max_stacks:1
  • base duration:25.00
  • duration modifier:1.00
  • base cooldown:1.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:agility
  • amount:190.00

Trigger Details

  • interval_min/max:300.0s / 319.9s
  • trigger_min/max:300.0s / 319.9s
  • trigger_pct:100.00%
  • duration_min/max:0.2s / 25.0s

Stack Uptimes

  • potion_of_spectral_agility_1:11.25%

Spelldata

  • id:307159
  • name:Potion of Spectral Agility
  • tooltip:Agility increased by $w1.
  • description:Increases your Agility by {$s1=190} for {$d=25 seconds}.
  • max_stacks:0
  • duration:25.00
  • cooldown:1.00
  • default_chance:0.00%
Precise Shots 40.4 9.8 7.4sec 6.0sec 3.1sec 41.75% 85.70% 4.9 (4.9) 0.0

Buff Details

  • buff initial source:call_ot_wild
  • cooldown name:buff_precise_shots
  • max_stacks:2
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.50
  • default_chance:101.00%
  • default_value:0.75
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.9s / 37.7s
  • trigger_min/max:0.9s / 14.3s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 32.9s

Stack Uptimes

  • precise_shots_1:35.26%
  • precise_shots_2:6.50%

Spelldata

  • id:260242
  • name:Precise Shots
  • tooltip:Damage of {$?s342049=false}[Chimaera Shot][Arcane Shot] or Multi-Shot increased by {$s1=75}%.
  • description:{$@spelldesc260240=Aimed Shot causes your next 1-{$260242u=2} {$?s342049=false}[Chimaera Shots][Arcane Shots] or Multi-Shots to deal {$260242s1=75}% more damage.}
  • max_stacks:2
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
Spectral Flask of Power 1.0 0.0 0.0sec 0.0sec 300.0sec 100.00% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:call_ot_wild
  • cooldown name:buff_spectral_flask_of_power
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:agility
  • amount:70.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:240.1s / 359.8s

Stack Uptimes

  • spectral_flask_of_power_1:100.00%

Spelldata

  • id:307185
  • name:Spectral Flask of Power
  • tooltip:$pri increased by $w1.
  • description:Increases $pri by {$s1=70} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Steady Focus 6.6 17.4 48.4sec 12.6sec 42.3sec 93.09% 0.00% 17.4 (17.4) 5.7

Buff Details

  • buff initial source:call_ot_wild
  • cooldown name:buff_steady_focus
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.07
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:15.0s / 253.8s
  • trigger_min/max:4.0s / 41.3s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 250.3s

Stack Uptimes

  • steady_focus_1:93.09%

Spelldata

  • id:193534
  • name:Steady Focus
  • tooltip:Haste increased by {$s1=7}%.
  • description:{$@spelldesc193533=Using Steady Shot twice in a row increases your Haste by {$193534s1=7}% for {$193534d=15 seconds}.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%

Trigger Spelldata

  • id:193533
  • name:Steady Focus
  • tooltip:
  • description:Using Steady Shot twice in a row increases your Haste by {$193534s1=7}% for {$193534d=15 seconds}.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
Trick Shots 68.3 12.9 4.4sec 3.7sec 3.8sec 87.17% 100.00% 12.9 (12.9) 0.0

Buff Details

  • buff initial source:call_ot_wild
  • cooldown name:buff_trick_shots
  • max_stacks:1
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:1.8s / 12.4s
  • trigger_min/max:0.9s / 10.2s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 12.4s

Stack Uptimes

  • trick_shots_1:87.17%

Spelldata

  • id:257622
  • name:Trick Shots
  • tooltip:Your next Aimed Shot or Rapid Fire will ricochet and hit {$257621s1=5} additional targets for {$257621s4=50}% of normal damage.
  • description:{$@spelldesc257621=When Multi-Shot hits {$s2=3} or more targets, your next Aimed Shot or Rapid Fire will ricochet and hit up to {$s1=5} additional targets for {$s4=50}% of normal damage.}
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
Trueshot 4.4 0.0 78.6sec 78.6sec 19.0sec 27.63% 0.00% 0.0 (0.0) 4.0

Buff Details

  • buff initial source:call_ot_wild
  • cooldown name:buff_trueshot
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.31
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.50
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:78.0s / 81.7s
  • trigger_min/max:78.0s / 81.7s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 19.7s

Stack Uptimes

  • trueshot_1:27.63%

Spelldata

  • id:288613
  • name:Trueshot
  • tooltip:The cooldown of Aimed Shot and Rapid Fire is reduced by ${$m1/4}%, and Aimed Shot casts {$s4=50}% faster. All Focus generation is increased by {$s5=50}%.
  • description:Reduces the cooldown of your Aimed Shot and Rapid Fire by ${$m1/4}%, and causes Aimed Shot to cast {$s4=50}% faster for {$d=15 seconds}. While Trueshot is active, you generate {$s5=50}% additional Focus.
  • max_stacks:0
  • duration:15.00
  • cooldown:120.00
  • default_chance:0.00%
Veiled Augmentation 1.0 0.0 0.0sec 0.0sec 300.0sec 100.00% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:call_ot_wild
  • cooldown name:buff_veiled_augmentation
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:agility
  • amount:18.00
  • stat:strength
  • amount:18.00
  • stat:intellect
  • amount:18.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:240.1s / 359.8s

Stack Uptimes

  • veiled_augmentation_1:100.00%

Spelldata

  • id:347901
  • name:Veiled Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=18} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Wild Spirits 3.0 0.0 120.6sec 120.6sec 17.5sec 17.44% 0.00% 0.0 (0.0) 2.8

Buff Details

  • buff initial source:call_ot_wild
  • cooldown name:buff_wild_spirits
  • max_stacks:1
  • base duration:18.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:120.0s / 122.7s
  • trigger_min/max:120.0s / 122.7s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 18.0s

Stack Uptimes

  • wild_spirits_1:17.44%

Spelldata

  • id:328837
  • name:Wild Spirits
  • tooltip:
  • description:{$@spelldesc328231=Evoke the energy of Wild Spirits at the target location, dealing {$328837s3=0} Nature damage and apply Hunter's Mark to all enemy targets within the area for {$328837d=15 seconds}. While the Wild Spirits are active, each damaging ability you or your pet use against a target in the area will strike up to $328757I nearby targets for {$328757s1=0} Nature damage.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
Windfury Totem 1.0 0.0 0.0sec 0.0sec 300.0sec 100.00% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:call_ot_wild
  • cooldown name:buff_windfury_totem
  • max_stacks:1
  • base duration:900.00
  • duration modifier:1.00
  • base cooldown:0.50
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:240.1s / 359.8s

Stack Uptimes

  • windfury_totem_1:100.00%

Spelldata

  • id:327942
  • name:Windfury Totem
  • tooltip:Your auto-attacks have a {$h=10}% chance to instantly attack again.
  • description:{$@spelldesc8512=Summons a Windfury Totem with {$s1=5} health at the feet of the caster for {$d=120 seconds}. Party members within {$s2=30} yds have a {$327942h=10}% chance when they auto-attack to swing an extra time.}
  • max_stacks:0
  • duration:120.00
  • cooldown:0.00
  • default_chance:10.00%
Constant Buffs
Arcane Intellect

Buff Details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff Details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:15.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
Power Word: Fortitude

Buff Details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.$?$w2>0[ Magic damage taken reduced by $w2%.][]
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Procs, Uptimes & Benefits

Proc Count Min Max Interval Min Max
double_tap_aimed 4.8 2.0 7.0 67.1s 47.1s 243.2s
double_tap_rapid_fire 0.7 0.0 3.0 112.6s 54.6s 302.2s
Uptime Avg % Min Max Avg Dur Min Max
Focus Cap 0.89% 0.68% 1.95% 0.9s 0.0s 2.4s

Cooldown waste details

Seconds per ExecuteSeconds per Iteration
AbilityAverageMinimumMaximumAverageMinimumMaximum
Double Tap0.7500.0012.7142.8410.0009.080
Aimed Shot1.4100.0016.90218.9965.72934.592
Kill Shot4.0380.00124.95313.1790.01430.151
Wild Spirits0.7070.0032.6811.1860.0005.038
Trueshot0.7530.0013.7192.1540.0007.899
Rapid Fire3.5720.00132.50953.95216.91090.841

Resources

Gains Type Count Total Tot% Avg Overflow Ovr%
call_ot_wild
steady_shot Focus 65.32 633.15 20.68% 9.69 20.06 3.07%
rapid_fire Focus 127.03 126.90 4.15% 1.00 0.13 0.11%
focus_regen Focus 614.94 1943.46 63.49% 3.16 19.46 0.99%
Trueshot Focus 238.40 357.56 11.68% 1.50 1.38 0.38%
Change Start Gain/s Loss/s Overflow (Total) End (Avg) Min Max
Focus 100.0 10.21 10.42 41.0 34.8 0.3 100.0
Usage Type Count Total Avg RPE APR
call_ot_wild
aimed_shot Focus 50.1 1457.4 29.1 29.1 871.8
kill_shot Focus 4.5 44.7 10.0 10.0 543.1
multishot Focus 81.2 1624.0 20.0 20.0 501.3

Statistics & Data Analysis

Fight Length
call_ot_wild Fight Length
Count 1217
Mean 299.97
Minimum 240.10
Maximum 359.83
Spread ( max - min ) 119.74
Range [ ( max - min ) / 2 * 100% ] 19.96%
DPS
call_ot_wild Damage Per Second
Count 1217
Mean 10914.55
Minimum 10108.98
Maximum 11894.13
Spread ( max - min ) 1785.15
Range [ ( max - min ) / 2 * 100% ] 8.18%
Standard Deviation 290.0519
5th Percentile 10462.91
95th Percentile 11413.76
( 95th Percentile - 5th Percentile ) 950.86
Mean Distribution
Standard Deviation 8.3144
95.00% Confidence Interval ( 10898.25 - 10930.84 )
Normalized 95.00% Confidence Interval ( 99.85% - 100.15% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 28
0.1% Error 2713
0.1 Scale Factor Error with Delta=300 719
0.05 Scale Factor Error with Delta=300 2873
0.01 Scale Factor Error with Delta=300 71819
Priority Target DPS
call_ot_wild Priority Target Damage Per Second
Count 1217
Mean 3767.42
Minimum 3402.64
Maximum 4168.33
Spread ( max - min ) 765.68
Range [ ( max - min ) / 2 * 100% ] 10.16%
Standard Deviation 122.5713
5th Percentile 3568.52
95th Percentile 3981.45
( 95th Percentile - 5th Percentile ) 412.93
Mean Distribution
Standard Deviation 3.5135
95.00% Confidence Interval ( 3760.53 - 3774.31 )
Normalized 95.00% Confidence Interval ( 99.82% - 100.18% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 41
0.1% Error 4067
0.1 Scale Factor Error with Delta=300 129
0.05 Scale Factor Error with Delta=300 514
0.01 Scale Factor Error with Delta=300 12826
DPS(e)
call_ot_wild Damage Per Second (Effective)
Count 1217
Mean 10914.55
Minimum 10108.98
Maximum 11894.13
Spread ( max - min ) 1785.15
Range [ ( max - min ) / 2 * 100% ] 8.18%
Damage
call_ot_wild Damage
Count 1217
Mean 3269650.28
Minimum 2439913.55
Maximum 4008436.57
Spread ( max - min ) 1568523.02
Range [ ( max - min ) / 2 * 100% ] 23.99%
DTPS
call_ot_wild Damage Taken Per Second
Count 1217
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
call_ot_wild Healing Per Second
Count 1217
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
call_ot_wild Healing Per Second (Effective)
Count 1217
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
call_ot_wild Heal
Count 1217
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
call_ot_wild Healing Taken Per Second
Count 1217
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
call_ot_wild Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
call_ot_wildTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
call_ot_wild Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask
1 0.00 augmentation
2 0.00 food
3 0.00 snapshot_stats
Snapshot raid buffed stats before combat begins and pre-potting is done.
4 0.00 tar_trap,if=runeforge.soulforge_embers
5 0.00 double_tap,precast_time=10,if=!covenant.kyrian&(!talent.volley|active_enemies<2)
6 0.00 aimed_shot,if=active_enemies<3
7 0.00 steady_shot,if=active_enemies>2
Default action list Executed every time the actor is available.
# count action,conditions
8 1.00 auto_shot
0.00 counter_shot,line_cd=30,if=runeforge.sephuzs_proclamation|soulbind.niyas_tools_poison|(conduit.reversal_of_fortune&!runeforge.sephuzs_proclamation)
9 3.74 use_items
A 0.00 call_action_list,name=cds
B 0.00 call_action_list,name=st,if=active_enemies<3
C 0.00 call_action_list,name=trickshots,if=active_enemies>2
actions.cds
# count action,conditions
0.00 berserking,if=buff.trueshot.up|target.time_to_die<13
D 2.67 blood_fury,if=buff.trueshot.up|target.time_to_die<16
0.00 ancestral_call,if=buff.trueshot.up|target.time_to_die<16
0.00 fireblood,if=buff.trueshot.up|target.time_to_die<9
0.00 lights_judgment,if=buff.trueshot.down
0.00 bag_of_tricks,if=buff.trueshot.down
E 1.47 potion,if=buff.trueshot.up&buff.bloodlust.up|buff.trueshot.up&target.health.pct<20|target.time_to_die<26
actions.trickshots
# count action,conditions
F 16.66 steady_shot,if=talent.steady_focus&in_flight&buff.steady_focus.remains<5
G 4.61 double_tap,if=covenant.kyrian&cooldown.resonating_arrow.remains<gcd|cooldown.rapid_fire.remains<cooldown.aimed_shot.full_recharge_time|!(talent.streamline&runeforge.surging_shots)|!covenant.kyrian
0.00 tar_trap,if=runeforge.soulforge_embers&tar_trap.remains<gcd&cooldown.flare.remains<gcd
0.00 flare,if=tar_trap.up&runeforge.soulforge_embers
0.00 explosive_shot
H 2.98 wild_spirits
0.00 resonating_arrow
0.00 volley
0.00 barrage
I 4.37 trueshot
0.00 rapid_fire,if=buff.trick_shots.remains>=execute_time&runeforge.surging_shots&buff.double_tap.down
J 50.31 aimed_shot,target_if=min:(dot.serpent_sting.remains<?action.serpent_sting.in_flight_to_target*dot.serpent_sting.duration),if=buff.trick_shots.remains>=execute_time&(buff.precise_shots.down|full_recharge_time<cast_time+gcd|buff.trueshot.up)
0.00 death_chakram,if=focus+cast_regen<focus.max
K 17.45 rapid_fire,if=buff.trick_shots.remains>=execute_time
L 76.22 multishot,if=buff.trick_shots.down|buff.precise_shots.up&focus>cost+action.aimed_shot.cost&(!talent.chimaera_shot|active_enemies>3)
0.00 chimaera_shot,if=buff.precise_shots.up&focus>cost+action.aimed_shot.cost&active_enemies<4
M 4.47 kill_shot,if=buff.dead_eye.down
0.00 a_murder_of_crows
0.00 flayed_shot
0.00 serpent_sting,target_if=min:dot.serpent_sting.remains,if=refreshable
N 4.98 multishot,if=focus>cost+action.aimed_shot.cost
O 47.92 steady_shot

Sample Sequence

0125789FHIDELJLJLKLJLOFJLJOLKLJLOJOFLJOLKLOJLOFONJLOJLOFGKLJLOJLOFLNOJLKLOFNJILOJLKLJ9LOFJLJOLKLJOFLJGLOLJLOFHJLKLOJLOFOJLLJLOKLJLOFLJLOIDJLKLJOFLGJLJLJLK9LOFJLJLOONONJLKLOFJLOONONJLOKLOFJLONGNJLOFIKHLJLJLKLJOFLJLKLOJLOFJ9LOOJLKLMOJLOFLGJLMOLJLKLMOFJLOOJLIDEMKLJOLKLJLMKLJOFLKLJLMOO

Sample Sequence Table

Time List # Name Target Resources Buffs
Pre precombat 0 flask call_ot_wild 100.0/100: 100% focus
Pre precombat 1 augmentation call_ot_wild 100.0/100: 100% focus
Pre precombat 2 food call_ot_wild 100.0/100: 100% focus
Pre precombat 5 double_tap Fluffy_Pillow 100.0/100: 100% focus
Pre precombat 7 steady_shot Fluffy_Pillow 100.0/100: 100% focus double_tap
0:00.000 default 8 auto_attack Fluffy_Pillow 100.0/100: 100% focus double_tap
0:00.000 default 9 use_items Fluffy_Pillow 100.0/100: 100% focus double_tap
0:00.000 trickshots F steady_shot Fluffy_Pillow 100.0/100: 100% focus double_tap
0:01.483 trickshots H wild_spirits Fluffy_Pillow 100.0/100: 100% focus bloodlust, double_tap, steady_focus
0:02.398 trickshots I trueshot Fluffy_Pillow 100.0/100: 100% focus bloodlust, double_tap, steady_focus
0:02.398 cds D blood_fury Fluffy_Pillow 100.0/100: 100% focus bloodlust, double_tap, steady_focus, trueshot
0:02.398 cds E potion Fluffy_Pillow 100.0/100: 100% focus bloodlust, blood_fury, double_tap, steady_focus, trueshot
0:02.398 trickshots L multishot Fluffy_Pillow 100.0/100: 100% focus bloodlust, blood_fury, double_tap, steady_focus, trueshot, potion_of_spectral_agility
0:03.316 trickshots J aimed_shot Fluffy_Pillow 91.3/100: 91% focus bloodlust, blood_fury, double_tap, steady_focus, trick_shots, trueshot, wild_spirits, potion_of_spectral_agility
0:04.231 trickshots L multishot Fluffy_Pillow 66.9/100: 67% focus bloodlust, blood_fury, precise_shots, steady_focus, trueshot, wild_spirits, potion_of_spectral_agility
0:05.146 trickshots J aimed_shot Fluffy_Pillow 58.2/100: 58% focus bloodlust, blood_fury, steady_focus, trick_shots, trueshot, wild_spirits, potion_of_spectral_agility
0:06.062 trickshots L multishot Fluffy_Pillow 34.5/100: 35% focus bloodlust, blood_fury, precise_shots(2), steady_focus, trueshot, wild_spirits, potion_of_spectral_agility
0:06.976 trickshots K rapid_fire Fluffy_Pillow 25.8/100: 26% focus bloodlust, blood_fury, precise_shots, steady_focus, trick_shots, trueshot, wild_spirits, potion_of_spectral_agility
0:08.501 trickshots L multishot Fluffy_Pillow 54.6/100: 55% focus bloodlust, blood_fury, precise_shots, steady_focus, trueshot, wild_spirits, potion_of_spectral_agility
0:09.417 trickshots J aimed_shot Fluffy_Pillow 45.9/100: 46% focus bloodlust, blood_fury, steady_focus, trick_shots, trueshot, wild_spirits, potion_of_spectral_agility
0:10.333 trickshots L multishot Fluffy_Pillow 22.2/100: 22% focus bloodlust, blood_fury, precise_shots(2), steady_focus, trueshot, wild_spirits, potion_of_spectral_agility
0:11.249 trickshots O steady_shot Fluffy_Pillow 13.5/100: 14% focus bloodlust, blood_fury, precise_shots, steady_focus, trick_shots, trueshot, wild_spirits, potion_of_spectral_agility
0:12.316 trickshots F steady_shot Fluffy_Pillow 41.7/100: 42% focus bloodlust, blood_fury, precise_shots, steady_focus, trick_shots, trueshot, wild_spirits, potion_of_spectral_agility
0:13.384 trickshots J aimed_shot Fluffy_Pillow 69.9/100: 70% focus bloodlust, blood_fury, precise_shots, steady_focus, trick_shots, trueshot, wild_spirits, potion_of_spectral_agility
0:14.299 trickshots L multishot Fluffy_Pillow 46.2/100: 46% focus bloodlust, blood_fury, precise_shots(2), steady_focus, trueshot, wild_spirits, potion_of_spectral_agility
0:15.214 trickshots J aimed_shot Fluffy_Pillow 37.5/100: 37% focus bloodlust, blood_fury, precise_shots, steady_focus, trick_shots, trueshot, wild_spirits, potion_of_spectral_agility
0:16.129 trickshots O steady_shot Fluffy_Pillow 13.8/100: 14% focus bloodlust, blood_fury, precise_shots(2), steady_focus, trueshot, wild_spirits, potion_of_spectral_agility
0:17.196 trickshots L multishot Fluffy_Pillow 41.9/100: 42% focus bloodlust, blood_fury, precise_shots(2), steady_focus, trueshot, wild_spirits, potion_of_spectral_agility
0:18.111 trickshots K rapid_fire Fluffy_Pillow 33.2/100: 33% focus bloodlust, precise_shots, steady_focus, trick_shots, trueshot, wild_spirits, potion_of_spectral_agility
0:19.480 trickshots L multishot Fluffy_Pillow 58.1/100: 58% focus bloodlust, precise_shots, steady_focus, trueshot, wild_spirits, potion_of_spectral_agility
0:20.397 trickshots J aimed_shot Fluffy_Pillow 49.4/100: 49% focus bloodlust, steady_focus, trick_shots, trueshot, wild_spirits, potion_of_spectral_agility
0:21.313 trickshots L multishot Fluffy_Pillow 25.8/100: 26% focus bloodlust, precise_shots, steady_focus, trueshot, potion_of_spectral_agility
0:22.229 trickshots O steady_shot Fluffy_Pillow 16.3/100: 16% focus bloodlust, steady_focus, trick_shots, potion_of_spectral_agility
0:23.297 trickshots J aimed_shot Fluffy_Pillow 35.1/100: 35% focus bloodlust, steady_focus, trick_shots, potion_of_spectral_agility
0:24.820 trickshots O steady_shot Fluffy_Pillow 12.6/100: 13% focus bloodlust, precise_shots, steady_focus, potion_of_spectral_agility
0:25.888 trickshots F steady_shot Fluffy_Pillow 31.4/100: 31% focus bloodlust, precise_shots, steady_focus, potion_of_spectral_agility
0:26.954 trickshots L multishot Fluffy_Pillow 50.2/100: 50% focus bloodlust, precise_shots, steady_focus, potion_of_spectral_agility
0:27.869 trickshots J aimed_shot Fluffy_Pillow 37.7/100: 38% focus bloodlust, steady_focus, trick_shots
0:29.393 trickshots O steady_shot Fluffy_Pillow 15.3/100: 15% focus bloodlust, precise_shots, steady_focus
0:30.460 trickshots L multishot Fluffy_Pillow 34.0/100: 34% focus bloodlust, precise_shots, steady_focus
0:31.374 trickshots K rapid_fire Fluffy_Pillow 21.6/100: 22% focus bloodlust, steady_focus, trick_shots
0:32.828 trickshots L multishot Fluffy_Pillow 40.5/100: 41% focus bloodlust, steady_focus
0:33.745 trickshots O steady_shot Fluffy_Pillow 28.1/100: 28% focus bloodlust, steady_focus, trick_shots
0:34.813 trickshots J aimed_shot Fluffy_Pillow 46.9/100: 47% focus bloodlust, steady_focus, trick_shots
0:36.337 trickshots L multishot Fluffy_Pillow 24.4/100: 24% focus bloodlust, precise_shots, steady_focus
0:37.255 trickshots O steady_shot Fluffy_Pillow 11.9/100: 12% focus bloodlust, steady_focus, trick_shots
0:38.321 trickshots F steady_shot Fluffy_Pillow 30.7/100: 31% focus bloodlust, steady_focus, trick_shots
0:39.389 trickshots O steady_shot Fluffy_Pillow 49.5/100: 50% focus bloodlust, steady_focus, trick_shots
0:40.455 trickshots N multishot Fluffy_Pillow 68.3/100: 68% focus bloodlust, steady_focus, trick_shots
0:41.369 trickshots J aimed_shot Fluffy_Pillow 55.1/100: 55% focus steady_focus, trick_shots
0:43.348 trickshots L multishot Fluffy_Pillow 32.6/100: 33% focus precise_shots, steady_focus
0:44.537 trickshots O steady_shot Fluffy_Pillow 20.1/100: 20% focus steady_focus, trick_shots
0:45.923 trickshots J aimed_shot Fluffy_Pillow 38.9/100: 39% focus lock_and_load, steady_focus, trick_shots
0:47.112 trickshots L multishot Fluffy_Pillow 46.4/100: 46% focus precise_shots(2), steady_focus
0:48.301 trickshots O steady_shot Fluffy_Pillow 34.0/100: 34% focus precise_shots, steady_focus, trick_shots
0:49.688 trickshots F steady_shot Fluffy_Pillow 52.7/100: 53% focus precise_shots, steady_focus, trick_shots
0:51.073 trickshots G double_tap Fluffy_Pillow 71.5/100: 72% focus precise_shots, steady_focus, trick_shots
0:52.260 trickshots K rapid_fire Fluffy_Pillow 79.0/100: 79% focus double_tap, precise_shots, steady_focus, trick_shots
0:54.120 trickshots L multishot Fluffy_Pillow 100.0/100: 100% focus precise_shots, steady_focus
0:55.308 trickshots J aimed_shot Fluffy_Pillow 87.5/100: 88% focus steady_focus, trick_shots
0:57.286 trickshots L multishot Fluffy_Pillow 65.0/100: 65% focus precise_shots, steady_focus
0:58.476 trickshots O steady_shot Fluffy_Pillow 52.6/100: 53% focus steady_focus, trick_shots
0:59.862 trickshots J aimed_shot Fluffy_Pillow 71.3/100: 71% focus steady_focus, trick_shots
1:01.966 trickshots L multishot Fluffy_Pillow 49.6/100: 50% focus precise_shots(2), steady_focus
1:03.155 trickshots O steady_shot Fluffy_Pillow 37.2/100: 37% focus precise_shots, steady_focus, trick_shots
1:04.542 trickshots F steady_shot Fluffy_Pillow 56.0/100: 56% focus precise_shots, steady_focus, trick_shots
1:05.929 trickshots L multishot Fluffy_Pillow 74.7/100: 75% focus precise_shots, steady_focus, trick_shots
1:07.119 trickshots N multishot Fluffy_Pillow 62.3/100: 62% focus steady_focus, trick_shots
1:08.306 trickshots O steady_shot Fluffy_Pillow 49.8/100: 50% focus steady_focus, trick_shots
1:09.692 trickshots J aimed_shot Fluffy_Pillow 68.5/100: 69% focus steady_focus, trick_shots
1:11.670 trickshots L multishot Fluffy_Pillow 46.1/100: 46% focus precise_shots, steady_focus
1:12.859 trickshots K rapid_fire Fluffy_Pillow 33.6/100: 34% focus steady_focus, trick_shots
1:14.604 trickshots L multishot Fluffy_Pillow 51.6/100: 52% focus steady_focus
1:15.790 trickshots O steady_shot Fluffy_Pillow 39.1/100: 39% focus steady_focus, trick_shots
1:17.176 trickshots F steady_shot Fluffy_Pillow 57.9/100: 58% focus steady_focus, trick_shots
1:18.560 trickshots N multishot Fluffy_Pillow 76.7/100: 77% focus steady_focus, trick_shots
1:19.748 trickshots J aimed_shot Fluffy_Pillow 64.2/100: 64% focus steady_focus, trick_shots
1:21.727 trickshots I trueshot Fluffy_Pillow 41.7/100: 42% focus precise_shots, steady_focus
1:21.727 trickshots L multishot Fluffy_Pillow 41.7/100: 42% focus precise_shots, steady_focus, trueshot
1:22.915 trickshots O steady_shot Fluffy_Pillow 33.0/100: 33% focus steady_focus, trick_shots, trueshot
1:24.301 trickshots J aimed_shot Fluffy_Pillow 61.2/100: 61% focus steady_focus, trick_shots, trueshot
1:25.490 trickshots L multishot Fluffy_Pillow 37.4/100: 37% focus precise_shots, steady_focus, trueshot
1:26.678 trickshots K rapid_fire Fluffy_Pillow 28.7/100: 29% focus steady_focus, trick_shots, trueshot
1:28.568 trickshots L multishot Fluffy_Pillow 53.7/100: 54% focus steady_focus, trueshot
1:29.756 trickshots J aimed_shot Fluffy_Pillow 44.9/100: 45% focus steady_focus, trick_shots, trueshot
1:30.943 default 9 use_items Fluffy_Pillow 21.2/100: 21% focus precise_shots, steady_focus, trueshot
1:30.943 trickshots L multishot Fluffy_Pillow 21.2/100: 21% focus precise_shots, steady_focus, trueshot
1:32.130 trickshots O steady_shot Fluffy_Pillow 12.5/100: 12% focus steady_focus, trick_shots, trueshot
1:33.519 trickshots F steady_shot Fluffy_Pillow 40.7/100: 41% focus steady_focus, trick_shots, trueshot
1:34.906 trickshots J aimed_shot Fluffy_Pillow 68.0/100: 68% focus steady_focus, trick_shots, trueshot
1:36.094 trickshots L multishot Fluffy_Pillow 44.3/100: 44% focus precise_shots(2), steady_focus, trueshot
1:37.282 trickshots J aimed_shot Fluffy_Pillow 35.6/100: 36% focus precise_shots, steady_focus, trick_shots, trueshot
1:38.469 trickshots O steady_shot Fluffy_Pillow 11.8/100: 12% focus precise_shots(2), steady_focus, trueshot
1:39.856 trickshots L multishot Fluffy_Pillow 40.0/100: 40% focus precise_shots(2), steady_focus, trueshot
1:41.045 trickshots K rapid_fire Fluffy_Pillow 31.3/100: 31% focus precise_shots, steady_focus, trick_shots, trueshot
1:42.786 trickshots L multishot Fluffy_Pillow 50.4/100: 50% focus precise_shots, steady_focus
1:43.974 trickshots J aimed_shot Fluffy_Pillow 37.9/100: 38% focus steady_focus, trick_shots
1:45.953 trickshots O steady_shot Fluffy_Pillow 15.4/100: 15% focus precise_shots(2), steady_focus
1:47.339 trickshots F steady_shot Fluffy_Pillow 34.2/100: 34% focus precise_shots(2), steady_focus
1:48.724 trickshots L multishot Fluffy_Pillow 52.9/100: 53% focus lock_and_load, precise_shots(2), steady_focus
1:49.913 trickshots J aimed_shot Fluffy_Pillow 40.5/100: 40% focus lock_and_load, precise_shots, steady_focus, trick_shots
1:51.102 trickshots G double_tap Fluffy_Pillow 48.0/100: 48% focus precise_shots(2), steady_focus
1:52.290 trickshots L multishot Fluffy_Pillow 55.5/100: 56% focus double_tap, precise_shots(2), steady_focus
1:53.479 trickshots O steady_shot Fluffy_Pillow 43.0/100: 43% focus double_tap, precise_shots, steady_focus, trick_shots
1:54.866 trickshots L multishot Fluffy_Pillow 61.8/100: 62% focus double_tap, precise_shots, steady_focus, trick_shots
1:56.054 trickshots J aimed_shot Fluffy_Pillow 49.3/100: 49% focus double_tap, steady_focus, trick_shots
1:58.032 trickshots L multishot Fluffy_Pillow 26.9/100: 27% focus precise_shots, steady_focus
1:59.222 trickshots O steady_shot Fluffy_Pillow 14.4/100: 14% focus steady_focus, trick_shots
2:00.608 trickshots F steady_shot Fluffy_Pillow 33.2/100: 33% focus steady_focus, trick_shots
2:01.994 trickshots H wild_spirits Fluffy_Pillow 51.9/100: 52% focus steady_focus, trick_shots
2:03.183 trickshots J aimed_shot Fluffy_Pillow 59.5/100: 59% focus steady_focus, trick_shots
2:05.161 trickshots L multishot Fluffy_Pillow 37.0/100: 37% focus precise_shots(2), steady_focus, wild_spirits
2:06.351 trickshots K rapid_fire Fluffy_Pillow 24.5/100: 25% focus precise_shots, steady_focus, trick_shots, wild_spirits
2:08.151 trickshots L multishot Fluffy_Pillow 42.9/100: 43% focus precise_shots, steady_focus, wild_spirits
2:09.340 trickshots O steady_shot Fluffy_Pillow 30.4/100: 30% focus steady_focus, trick_shots, wild_spirits
2:10.727 trickshots J aimed_shot Fluffy_Pillow 49.2/100: 49% focus steady_focus, trick_shots, wild_spirits
2:12.704 trickshots L multishot Fluffy_Pillow 26.7/100: 27% focus precise_shots(2), steady_focus, wild_spirits
2:13.893 trickshots O steady_shot Fluffy_Pillow 14.2/100: 14% focus precise_shots, steady_focus, trick_shots, wild_spirits
2:15.280 trickshots F steady_shot Fluffy_Pillow 33.0/100: 33% focus precise_shots, steady_focus, trick_shots, wild_spirits
2:16.667 trickshots O steady_shot Fluffy_Pillow 51.8/100: 52% focus precise_shots, steady_focus, trick_shots, wild_spirits
2:18.053 trickshots J aimed_shot Fluffy_Pillow 70.6/100: 71% focus lock_and_load, precise_shots, steady_focus, trick_shots, wild_spirits
2:19.241 trickshots L multishot Fluffy_Pillow 78.1/100: 78% focus precise_shots(2), steady_focus, wild_spirits
2:20.429 trickshots L multishot Fluffy_Pillow 65.6/100: 66% focus precise_shots, steady_focus, trick_shots, wild_spirits
2:21.617 trickshots J aimed_shot Fluffy_Pillow 53.1/100: 53% focus steady_focus, trick_shots
2:23.595 trickshots L multishot Fluffy_Pillow 30.6/100: 31% focus precise_shots(2), steady_focus
2:24.783 trickshots O steady_shot Fluffy_Pillow 18.2/100: 18% focus precise_shots, steady_focus, trick_shots
2:26.172 trickshots K rapid_fire Fluffy_Pillow 37.0/100: 37% focus precise_shots, steady_focus, trick_shots
2:28.099 trickshots L multishot Fluffy_Pillow 56.2/100: 56% focus precise_shots, steady_focus
2:29.288 trickshots J aimed_shot Fluffy_Pillow 43.7/100: 44% focus steady_focus, trick_shots
2:31.265 trickshots L multishot Fluffy_Pillow 21.2/100: 21% focus precise_shots(2), steady_focus
2:32.454 trickshots O steady_shot Fluffy_Pillow 8.4/100: 8% focus precise_shots, trick_shots
2:33.938 trickshots F steady_shot Fluffy_Pillow 27.2/100: 27% focus lock_and_load, precise_shots, trick_shots
2:35.420 trickshots L multishot Fluffy_Pillow 45.9/100: 46% focus lock_and_load, precise_shots, steady_focus, trick_shots
2:36.609 trickshots J aimed_shot Fluffy_Pillow 33.5/100: 33% focus lock_and_load, steady_focus, trick_shots
2:37.798 trickshots L multishot Fluffy_Pillow 41.0/100: 41% focus precise_shots(2), steady_focus
2:38.987 trickshots O steady_shot Fluffy_Pillow 28.5/100: 29% focus precise_shots, steady_focus, trick_shots
2:40.375 trickshots I trueshot Fluffy_Pillow 47.3/100: 47% focus precise_shots, steady_focus, trick_shots
2:40.375 cds D blood_fury Fluffy_Pillow 47.3/100: 47% focus precise_shots, steady_focus, trick_shots, trueshot
2:40.375 trickshots J aimed_shot Fluffy_Pillow 47.3/100: 47% focus blood_fury, precise_shots, steady_focus, trick_shots, trueshot
2:41.563 trickshots L multishot Fluffy_Pillow 23.6/100: 24% focus blood_fury, precise_shots(2), steady_focus, trueshot
2:42.752 trickshots K rapid_fire Fluffy_Pillow 14.9/100: 15% focus blood_fury, precise_shots, steady_focus, trick_shots, trueshot
2:44.547 trickshots L multishot Fluffy_Pillow 45.9/100: 46% focus blood_fury, precise_shots, steady_focus, trueshot
2:45.734 trickshots J aimed_shot Fluffy_Pillow 37.2/100: 37% focus blood_fury, steady_focus, trick_shots, trueshot
2:46.922 trickshots O steady_shot Fluffy_Pillow 13.4/100: 13% focus blood_fury, precise_shots, steady_focus, trueshot
2:48.309 trickshots F steady_shot Fluffy_Pillow 41.6/100: 42% focus blood_fury, precise_shots, steady_focus, trueshot
2:49.695 trickshots L multishot Fluffy_Pillow 69.8/100: 70% focus blood_fury, precise_shots, steady_focus, trueshot
2:50.884 trickshots G double_tap Fluffy_Pillow 61.1/100: 61% focus blood_fury, steady_focus, trick_shots, trueshot
2:52.290 trickshots J aimed_shot Fluffy_Pillow 74.4/100: 74% focus blood_fury, double_tap, steady_focus, trick_shots, trueshot
2:53.479 trickshots L multishot Fluffy_Pillow 50.7/100: 51% focus blood_fury, precise_shots(2), steady_focus, trueshot
2:54.668 trickshots J aimed_shot Fluffy_Pillow 42.0/100: 42% focus blood_fury, lock_and_load, precise_shots, steady_focus, trick_shots, trueshot
2:55.857 trickshots L multishot Fluffy_Pillow 53.3/100: 53% focus precise_shots(2), steady_focus, trueshot
2:57.045 trickshots J aimed_shot Fluffy_Pillow 44.6/100: 45% focus precise_shots, steady_focus, trick_shots, trueshot
2:58.236 trickshots L multishot Fluffy_Pillow 20.9/100: 21% focus precise_shots(2), steady_focus, trueshot
2:59.425 trickshots K rapid_fire Fluffy_Pillow 12.2/100: 12% focus precise_shots, steady_focus, trick_shots, trueshot
3:01.247 default 9 use_items Fluffy_Pillow 34.6/100: 35% focus precise_shots, steady_focus
3:01.247 trickshots L multishot Fluffy_Pillow 34.6/100: 35% focus precise_shots, steady_focus
3:02.434 trickshots O steady_shot Fluffy_Pillow 22.1/100: 22% focus steady_focus, trick_shots
3:03.820 trickshots F steady_shot Fluffy_Pillow 40.9/100: 41% focus steady_focus, trick_shots
3:05.206 trickshots J aimed_shot Fluffy_Pillow 59.4/100: 59% focus steady_focus, trick_shots
3:07.184 trickshots L multishot Fluffy_Pillow 36.9/100: 37% focus lock_and_load, precise_shots, steady_focus
3:08.373 trickshots J aimed_shot Fluffy_Pillow 24.5/100: 24% focus lock_and_load, steady_focus, trick_shots
3:09.561 trickshots L multishot Fluffy_Pillow 32.0/100: 32% focus precise_shots, steady_focus
3:10.750 trickshots O steady_shot Fluffy_Pillow 19.5/100: 20% focus steady_focus, trick_shots
3:12.136 trickshots O steady_shot Fluffy_Pillow 38.3/100: 38% focus steady_focus, trick_shots
3:13.522 trickshots N multishot Fluffy_Pillow 57.1/100: 57% focus steady_focus, trick_shots
3:14.709 trickshots O steady_shot Fluffy_Pillow 44.6/100: 45% focus steady_focus, trick_shots
3:16.094 trickshots N multishot Fluffy_Pillow 63.3/100: 63% focus steady_focus, trick_shots
3:17.281 trickshots J aimed_shot Fluffy_Pillow 50.9/100: 51% focus steady_focus, trick_shots
3:19.260 trickshots L multishot Fluffy_Pillow 28.4/100: 28% focus precise_shots, steady_focus
3:20.449 trickshots K rapid_fire Fluffy_Pillow 15.9/100: 16% focus steady_focus, trick_shots
3:22.240 trickshots L multishot Fluffy_Pillow 34.2/100: 34% focus steady_focus
3:23.426 trickshots O steady_shot Fluffy_Pillow 21.7/100: 22% focus steady_focus, trick_shots
3:24.812 trickshots F steady_shot Fluffy_Pillow 40.5/100: 41% focus steady_focus, trick_shots
3:26.199 trickshots J aimed_shot Fluffy_Pillow 59.3/100: 59% focus steady_focus, trick_shots
3:28.177 trickshots L multishot Fluffy_Pillow 36.8/100: 37% focus precise_shots, steady_focus
3:29.366 trickshots O steady_shot Fluffy_Pillow 24.3/100: 24% focus steady_focus, trick_shots
3:30.751 trickshots O steady_shot Fluffy_Pillow 43.1/100: 43% focus steady_focus, trick_shots
3:32.138 trickshots N multishot Fluffy_Pillow 61.9/100: 62% focus steady_focus, trick_shots
3:33.327 trickshots O steady_shot Fluffy_Pillow 49.4/100: 49% focus steady_focus, trick_shots
3:34.712 trickshots N multishot Fluffy_Pillow 68.2/100: 68% focus steady_focus, trick_shots
3:35.901 trickshots J aimed_shot Fluffy_Pillow 55.7/100: 56% focus steady_focus, trick_shots
3:37.879 trickshots L multishot Fluffy_Pillow 33.2/100: 33% focus precise_shots(2), steady_focus
3:39.066 trickshots O steady_shot Fluffy_Pillow 20.7/100: 21% focus precise_shots, steady_focus, trick_shots
3:40.450 trickshots K rapid_fire Fluffy_Pillow 39.5/100: 39% focus precise_shots, steady_focus, trick_shots
3:42.251 trickshots L multishot Fluffy_Pillow 57.9/100: 58% focus precise_shots, steady_focus
3:43.440 trickshots O steady_shot Fluffy_Pillow 45.4/100: 45% focus steady_focus, trick_shots
3:44.828 trickshots F steady_shot Fluffy_Pillow 64.2/100: 64% focus steady_focus, trick_shots
3:46.216 trickshots J aimed_shot Fluffy_Pillow 83.0/100: 83% focus steady_focus, trick_shots
3:48.195 trickshots L multishot Fluffy_Pillow 60.5/100: 61% focus precise_shots, steady_focus
3:49.384 trickshots O steady_shot Fluffy_Pillow 48.0/100: 48% focus steady_focus, trick_shots
3:50.771 trickshots N multishot Fluffy_Pillow 66.8/100: 67% focus steady_focus, trick_shots
3:51.959 trickshots G double_tap Fluffy_Pillow 54.3/100: 54% focus steady_focus, trick_shots
3:53.147 trickshots N multishot Fluffy_Pillow 61.9/100: 62% focus double_tap, steady_focus, trick_shots
3:54.334 trickshots J aimed_shot Fluffy_Pillow 49.4/100: 49% focus double_tap, steady_focus, trick_shots
3:56.554 trickshots L multishot Fluffy_Pillow 28.4/100: 28% focus precise_shots, steady_focus
3:57.744 trickshots O steady_shot Fluffy_Pillow 16.0/100: 16% focus steady_focus, trick_shots
3:59.132 trickshots F steady_shot Fluffy_Pillow 34.7/100: 35% focus steady_focus, trick_shots
4:00.518 trickshots I trueshot Fluffy_Pillow 53.5/100: 54% focus steady_focus, trick_shots
4:00.518 trickshots K rapid_fire Fluffy_Pillow 53.5/100: 54% focus steady_focus, trick_shots, trueshot
4:02.332 trickshots H wild_spirits Fluffy_Pillow 79.7/100: 80% focus steady_focus, trueshot
4:03.522 trickshots L multishot Fluffy_Pillow 91.0/100: 91% focus steady_focus, trueshot
4:04.712 trickshots J aimed_shot Fluffy_Pillow 82.3/100: 82% focus steady_focus, trick_shots, trueshot, wild_spirits
4:05.900 trickshots L multishot Fluffy_Pillow 58.6/100: 59% focus precise_shots, steady_focus, trueshot, wild_spirits
4:07.089 trickshots J aimed_shot Fluffy_Pillow 49.9/100: 50% focus steady_focus, trick_shots, trueshot, wild_spirits
4:08.277 trickshots L multishot Fluffy_Pillow 26.2/100: 26% focus precise_shots, steady_focus, trueshot, wild_spirits
4:09.465 trickshots K rapid_fire Fluffy_Pillow 17.4/100: 17% focus steady_focus, trick_shots, trueshot, wild_spirits
4:11.231 trickshots L multishot Fluffy_Pillow 44.2/100: 44% focus steady_focus, trueshot, wild_spirits
4:12.419 trickshots J aimed_shot Fluffy_Pillow 35.5/100: 35% focus steady_focus, trick_shots, trueshot, wild_spirits
4:13.606 trickshots O steady_shot Fluffy_Pillow 11.8/100: 12% focus precise_shots, steady_focus, trueshot, wild_spirits
4:14.993 trickshots F steady_shot Fluffy_Pillow 39.9/100: 40% focus precise_shots, steady_focus, trueshot, wild_spirits
4:16.378 trickshots L multishot Fluffy_Pillow 67.5/100: 68% focus precise_shots, steady_focus, trueshot, wild_spirits
4:17.566 trickshots J aimed_shot Fluffy_Pillow 58.8/100: 59% focus steady_focus, trick_shots, trueshot, wild_spirits
4:18.756 trickshots L multishot Fluffy_Pillow 35.1/100: 35% focus precise_shots(2), steady_focus, trueshot, wild_spirits
4:19.944 trickshots K rapid_fire Fluffy_Pillow 26.4/100: 26% focus precise_shots, steady_focus, trick_shots, trueshot, wild_spirits
4:21.791 trickshots L multishot Fluffy_Pillow 45.8/100: 46% focus precise_shots, steady_focus
4:22.980 trickshots O steady_shot Fluffy_Pillow 33.3/100: 33% focus steady_focus, trick_shots
4:24.366 trickshots J aimed_shot Fluffy_Pillow 52.1/100: 52% focus steady_focus, trick_shots
4:26.343 trickshots L multishot Fluffy_Pillow 29.6/100: 30% focus precise_shots, steady_focus
4:27.531 trickshots O steady_shot Fluffy_Pillow 17.1/100: 17% focus steady_focus, trick_shots
4:28.916 trickshots F steady_shot Fluffy_Pillow 35.9/100: 36% focus steady_focus, trick_shots
4:30.301 trickshots J aimed_shot Fluffy_Pillow 54.7/100: 55% focus steady_focus, trick_shots
4:32.279 default 9 use_items Fluffy_Pillow 32.2/100: 32% focus precise_shots, steady_focus
4:32.279 trickshots L multishot Fluffy_Pillow 32.2/100: 32% focus precise_shots, steady_focus
4:33.469 trickshots O steady_shot Fluffy_Pillow 19.7/100: 20% focus steady_focus, trick_shots
4:34.856 trickshots O steady_shot Fluffy_Pillow 38.5/100: 38% focus steady_focus, trick_shots
4:36.244 trickshots J aimed_shot Fluffy_Pillow 57.3/100: 57% focus steady_focus, trick_shots
4:38.222 trickshots L multishot Fluffy_Pillow 34.8/100: 35% focus precise_shots, steady_focus
4:39.411 trickshots K rapid_fire Fluffy_Pillow 22.3/100: 22% focus steady_focus, trick_shots
4:41.311 trickshots L multishot Fluffy_Pillow 41.3/100: 41% focus steady_focus
4:42.499 trickshots M kill_shot Fluffy_Pillow 28.9/100: 29% focus steady_focus, trick_shots
4:43.687 trickshots O steady_shot Fluffy_Pillow 26.4/100: 26% focus steady_focus, trick_shots
4:45.073 trickshots J aimed_shot Fluffy_Pillow 45.2/100: 45% focus steady_focus, trick_shots
4:47.278 trickshots L multishot Fluffy_Pillow 24.1/100: 24% focus lock_and_load, precise_shots(2), steady_focus
4:48.465 trickshots O steady_shot Fluffy_Pillow 11.6/100: 12% focus lock_and_load, precise_shots, steady_focus, trick_shots
4:49.851 trickshots F steady_shot Fluffy_Pillow 30.4/100: 30% focus lock_and_load, precise_shots, steady_focus, trick_shots
4:51.237 trickshots L multishot Fluffy_Pillow 49.2/100: 49% focus lock_and_load, precise_shots, steady_focus, trick_shots
4:52.426 trickshots G double_tap Fluffy_Pillow 36.7/100: 37% focus lock_and_load, steady_focus, trick_shots
4:53.613 trickshots J aimed_shot Fluffy_Pillow 44.2/100: 44% focus double_tap, lock_and_load, steady_focus, trick_shots
4:54.801 trickshots L multishot Fluffy_Pillow 51.7/100: 52% focus precise_shots(2), steady_focus
4:55.989 trickshots M kill_shot Fluffy_Pillow 39.2/100: 39% focus precise_shots, steady_focus, trick_shots
4:57.177 trickshots O steady_shot Fluffy_Pillow 36.8/100: 37% focus precise_shots, steady_focus, trick_shots
4:58.563 trickshots L multishot Fluffy_Pillow 55.5/100: 56% focus precise_shots, steady_focus, trick_shots
4:59.753 trickshots J aimed_shot Fluffy_Pillow 43.1/100: 43% focus steady_focus, trick_shots
5:01.733 trickshots L multishot Fluffy_Pillow 20.6/100: 21% focus precise_shots, steady_focus
5:02.923 trickshots K rapid_fire Fluffy_Pillow 8.1/100: 8% focus steady_focus, trick_shots
5:04.679 trickshots L multishot Fluffy_Pillow 26.2/100: 26% focus steady_focus
5:05.869 trickshots M kill_shot Fluffy_Pillow 13.8/100: 14% focus steady_focus, trick_shots
5:07.179 trickshots O steady_shot Fluffy_Pillow 11.7/100: 12% focus trick_shots
5:08.662 trickshots F steady_shot Fluffy_Pillow 30.4/100: 30% focus trick_shots
5:10.145 trickshots J aimed_shot Fluffy_Pillow 49.2/100: 49% focus steady_focus, trick_shots
5:12.124 trickshots L multishot Fluffy_Pillow 26.7/100: 27% focus precise_shots, steady_focus
5:13.310 trickshots O steady_shot Fluffy_Pillow 14.3/100: 14% focus steady_focus, trick_shots
5:14.698 trickshots O steady_shot Fluffy_Pillow 33.0/100: 33% focus steady_focus, trick_shots
5:16.085 trickshots J aimed_shot Fluffy_Pillow 51.8/100: 52% focus steady_focus, trick_shots
5:18.062 trickshots L multishot Fluffy_Pillow 29.3/100: 29% focus precise_shots(2), steady_focus
5:19.252 trickshots I trueshot Fluffy_Pillow 16.9/100: 17% focus precise_shots, steady_focus, trick_shots
5:19.252 cds D blood_fury Fluffy_Pillow 16.9/100: 17% focus precise_shots, steady_focus, trick_shots, trueshot
5:19.252 cds E potion Fluffy_Pillow 16.9/100: 17% focus blood_fury, precise_shots, steady_focus, trick_shots, trueshot
5:19.252 trickshots M kill_shot Fluffy_Pillow 16.9/100: 17% focus blood_fury, precise_shots, steady_focus, trick_shots, trueshot, potion_of_spectral_agility
5:20.441 trickshots K rapid_fire Fluffy_Pillow 18.2/100: 18% focus blood_fury, precise_shots, steady_focus, trick_shots, trueshot, potion_of_spectral_agility
5:22.255 trickshots L multishot Fluffy_Pillow 46.4/100: 46% focus blood_fury, precise_shots, steady_focus, trueshot, potion_of_spectral_agility
5:23.444 trickshots J aimed_shot Fluffy_Pillow 37.7/100: 38% focus blood_fury, steady_focus, trick_shots, trueshot, potion_of_spectral_agility
5:24.631 trickshots O steady_shot Fluffy_Pillow 13.9/100: 14% focus blood_fury, precise_shots, steady_focus, trueshot, potion_of_spectral_agility
5:26.017 trickshots L multishot Fluffy_Pillow 42.1/100: 42% focus blood_fury, precise_shots, steady_focus, trueshot, potion_of_spectral_agility
5:27.206 trickshots K rapid_fire Fluffy_Pillow 33.4/100: 33% focus blood_fury, steady_focus, trick_shots, trueshot, potion_of_spectral_agility
5:29.012 trickshots L multishot Fluffy_Pillow 61.5/100: 62% focus blood_fury, steady_focus, trueshot, potion_of_spectral_agility
5:30.201 trickshots J aimed_shot Fluffy_Pillow 52.8/100: 53% focus blood_fury, steady_focus, trick_shots, trueshot, potion_of_spectral_agility
5:31.392 trickshots L multishot Fluffy_Pillow 28.9/100: 29% focus blood_fury, precise_shots, trueshot, potion_of_spectral_agility
5:32.664 trickshots M kill_shot Fluffy_Pillow 20.2/100: 20% focus blood_fury, trick_shots, trueshot, potion_of_spectral_agility
5:33.934 trickshots K rapid_fire Fluffy_Pillow 21.5/100: 21% focus blood_fury, trick_shots, trueshot, potion_of_spectral_agility
5:35.731 trickshots L multishot Fluffy_Pillow 47.4/100: 47% focus trueshot, potion_of_spectral_agility
5:37.002 trickshots J aimed_shot Fluffy_Pillow 38.7/100: 39% focus trick_shots, trueshot, potion_of_spectral_agility
5:38.273 trickshots O steady_shot Fluffy_Pillow 15.0/100: 15% focus precise_shots(2), trueshot, potion_of_spectral_agility
5:39.754 trickshots F steady_shot Fluffy_Pillow 35.6/100: 36% focus precise_shots(2), potion_of_spectral_agility
5:41.238 trickshots L multishot Fluffy_Pillow 54.4/100: 54% focus precise_shots(2), steady_focus, potion_of_spectral_agility
5:42.427 trickshots K rapid_fire Fluffy_Pillow 41.9/100: 42% focus precise_shots, steady_focus, trick_shots, potion_of_spectral_agility
5:44.274 trickshots L multishot Fluffy_Pillow 60.6/100: 61% focus precise_shots, steady_focus
5:45.465 trickshots J aimed_shot Fluffy_Pillow 48.1/100: 48% focus steady_focus, trick_shots
5:47.444 trickshots L multishot Fluffy_Pillow 25.7/100: 26% focus precise_shots, steady_focus
5:48.632 trickshots M kill_shot Fluffy_Pillow 13.2/100: 13% focus steady_focus, trick_shots
5:49.822 trickshots O steady_shot Fluffy_Pillow 10.7/100: 11% focus steady_focus, trick_shots
5:51.209 trickshots O steady_shot Fluffy_Pillow 29.5/100: 29% focus steady_focus, trick_shots

Stats

Level Bonus (60) Race Bonus (orc) Raid-Buffed Unbuffed Gear Amount
Strength 274 3 295 277 0
Agility 450 -3 1411 1297 789 (677)
Stamina 414 1 1800 1715 1300
Intellect 369 -1 405 368 0
Spirit 0 0 0 0 0
Health 36000 34300 0
Focus 100 100 0
Spell Power 405 368 0
Crit 22.66% 22.66% 443
Haste 18.30% 18.30% 604
Versatility 3.65% 3.65% 146
Attack Power 1482 1297 0
Mastery 14.00% 14.00% 504
Armor 818 818 818
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 217.00
Local Head Helm of Insatiable Appetite
ilevel: 213, stats: { 103 Armor, +126 Sta, +92 Haste, +40 Mastery, +72 AgiInt }
Local Neck Noble's Birthstone Pendant
ilevel: 213, stats: { +71 Sta, +47 Crit, +147 Mastery }
Local Shoulders Boneshatter Pauldrons
ilevel: 235, stats: { 107 Armor, +124 Sta, +44 unknown(24), +44 unknown(25), +66 AgiInt }
item effects: { equip: Call of the Wild }
Local Chest Master Huntsman's Bandolier
ilevel: 213, stats: { 137 Armor, +126 Sta, +45 Crit, +86 Mastery, +72 AgiInt }, enchant: { +20 StrAgi }
Local Waist Load-Bearing Belt
ilevel: 213, stats: { 77 Armor, +95 Sta, +69 Haste, +30 Vers, +54 AgiInt }
Local Legs Greaves of Enigmatic Energies
ilevel: 213, stats: { 120 Armor, +126 Sta, +91 Crit, +41 Mastery, +72 AgiInt }
Local Feet Stoneclas Stompers
ilevel: 213, stats: { 86 Armor, +95 Sta, +69 Crit, +30 Mastery, +54 AgiInt }, enchant: { +15 Agi }
Local Wrists Bangles of Errant Pride
ilevel: 213, stats: { 69 Armor, +71 Sta, +48 Crit, +24 Mastery, +40 AgiInt }
Local Hands Oathsworn Soldier's Gauntlets
ilevel: 220, stats: { 80 Armor, +104 Sta, +67 Crit, +36 Haste, +58 AgiInt }
Local Finger1 Most Regal Signet of Sire Denathrius
ilevel: 220, stats: { +77 Sta, +161 Haste, +44 Mastery }, enchant: { +16 Crit }
item effects: { equip: Denathrius' Privilege }
Local Finger2 Ritualist's Treasured Ring
ilevel: 213, stats: { +71 Sta, +44 Crit, +149 Haste }, enchant: { +16 Crit }
Local Trinket1 Dreadfire Vessel
ilevel: 220, stats: { +73 StrAgiInt }, enchant: shadowcore_oil
item effects: { use: Dreadfire Vessel }
Local Trinket2 Stone Legion Heraldry
ilevel: 220, stats: { +73 StrAgi }
item effects: { equip: Stone Legionnaire }
Local Back Crest of the Legionnaire General
ilevel: 220, stats: { 39 Armor, +77 Sta, +52 Haste, +24 Vers, +43 StrAgiInt }
Local Main Hand Deadeye Blunderbuss
ilevel: 220, weapon: { 121 - 227, 3 }, stats: { +77 Agi, +137 Sta, +45 Haste, +92 Mastery }, enchant: sinful_revelation

Profile

hunter="call_ot_wild"
source=default
spec=marksmanship
level=60
race=orc
role=attack
position=ranged_back
talents=1101032
covenant=night_fae
soulbind=140:6//188:6

# Default consumables
potion=spectral_agility
flask=spectral_flask_of_power
food=feast_of_gluttonous_hedonism
augmentation=veiled

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask
actions.precombat+=/augmentation
actions.precombat+=/food
# Snapshot raid buffed stats before combat begins and pre-potting is done.
actions.precombat+=/snapshot_stats
actions.precombat+=/tar_trap,if=runeforge.soulforge_embers
actions.precombat+=/double_tap,precast_time=10,if=!covenant.kyrian&(!talent.volley|active_enemies<2)
actions.precombat+=/aimed_shot,if=active_enemies<3
actions.precombat+=/steady_shot,if=active_enemies>2

# Executed every time the actor is available.
actions=auto_shot
actions+=/counter_shot,line_cd=30,if=runeforge.sephuzs_proclamation|soulbind.niyas_tools_poison|(conduit.reversal_of_fortune&!runeforge.sephuzs_proclamation)
actions+=/use_items
actions+=/call_action_list,name=cds
actions+=/call_action_list,name=st,if=active_enemies<3
actions+=/call_action_list,name=trickshots,if=active_enemies>2

actions.cds=berserking,if=buff.trueshot.up|target.time_to_die<13
actions.cds+=/blood_fury,if=buff.trueshot.up|target.time_to_die<16
actions.cds+=/ancestral_call,if=buff.trueshot.up|target.time_to_die<16
actions.cds+=/fireblood,if=buff.trueshot.up|target.time_to_die<9
actions.cds+=/lights_judgment,if=buff.trueshot.down
actions.cds+=/bag_of_tricks,if=buff.trueshot.down
actions.cds+=/potion,if=buff.trueshot.up&buff.bloodlust.up|buff.trueshot.up&target.health.pct<20|target.time_to_die<26

actions.st=steady_shot,if=talent.steady_focus&(prev_gcd.1.steady_shot&buff.steady_focus.remains<5|buff.steady_focus.down)
actions.st+=/kill_shot
actions.st+=/double_tap,if=covenant.kyrian&cooldown.resonating_arrow.remains<gcd|!covenant.kyrian&(cooldown.aimed_shot.up|cooldown.rapid_fire.remains>cooldown.aimed_shot.remains)
actions.st+=/flare,if=tar_trap.up&runeforge.soulforge_embers
actions.st+=/tar_trap,if=runeforge.soulforge_embers&tar_trap.remains<gcd&cooldown.flare.remains<gcd
actions.st+=/explosive_shot
actions.st+=/wild_spirits
actions.st+=/flayed_shot
actions.st+=/death_chakram,if=focus+cast_regen<focus.max
actions.st+=/volley,if=buff.precise_shots.down|!talent.chimaera_shot|active_enemies<2
actions.st+=/a_murder_of_crows
actions.st+=/resonating_arrow
actions.st+=/trueshot,if=buff.precise_shots.down|buff.resonating_arrow.up|buff.wild_spirits.up|buff.volley.up&active_enemies>1
actions.st+=/aimed_shot,target_if=min:(dot.serpent_sting.remains<?action.serpent_sting.in_flight_to_target*dot.serpent_sting.duration),if=buff.precise_shots.down|(buff.trueshot.up|full_recharge_time<gcd+cast_time)&(!talent.chimaera_shot|active_enemies<2)|buff.trick_shots.remains>execute_time&active_enemies>1
actions.st+=/rapid_fire,if=focus+cast_regen<focus.max&(buff.trueshot.down|!runeforge.eagletalons_true_focus)&(buff.double_tap.down|talent.streamline)
actions.st+=/chimaera_shot,if=buff.precise_shots.up|focus>cost+action.aimed_shot.cost
actions.st+=/arcane_shot,if=buff.precise_shots.up|focus>cost+action.aimed_shot.cost
actions.st+=/serpent_sting,target_if=min:remains,if=refreshable&target.time_to_die>duration
actions.st+=/barrage,if=active_enemies>1
actions.st+=/rapid_fire,if=focus+cast_regen<focus.max&(buff.double_tap.down|talent.streamline)
actions.st+=/steady_shot

actions.trickshots=steady_shot,if=talent.steady_focus&in_flight&buff.steady_focus.remains<5
actions.trickshots+=/double_tap,if=covenant.kyrian&cooldown.resonating_arrow.remains<gcd|cooldown.rapid_fire.remains<cooldown.aimed_shot.full_recharge_time|!(talent.streamline&runeforge.surging_shots)|!covenant.kyrian
actions.trickshots+=/tar_trap,if=runeforge.soulforge_embers&tar_trap.remains<gcd&cooldown.flare.remains<gcd
actions.trickshots+=/flare,if=tar_trap.up&runeforge.soulforge_embers
actions.trickshots+=/explosive_shot
actions.trickshots+=/wild_spirits
actions.trickshots+=/resonating_arrow
actions.trickshots+=/volley
actions.trickshots+=/barrage
actions.trickshots+=/trueshot
actions.trickshots+=/rapid_fire,if=buff.trick_shots.remains>=execute_time&runeforge.surging_shots&buff.double_tap.down
actions.trickshots+=/aimed_shot,target_if=min:(dot.serpent_sting.remains<?action.serpent_sting.in_flight_to_target*dot.serpent_sting.duration),if=buff.trick_shots.remains>=execute_time&(buff.precise_shots.down|full_recharge_time<cast_time+gcd|buff.trueshot.up)
actions.trickshots+=/death_chakram,if=focus+cast_regen<focus.max
actions.trickshots+=/rapid_fire,if=buff.trick_shots.remains>=execute_time
actions.trickshots+=/multishot,if=buff.trick_shots.down|buff.precise_shots.up&focus>cost+action.aimed_shot.cost&(!talent.chimaera_shot|active_enemies>3)
actions.trickshots+=/chimaera_shot,if=buff.precise_shots.up&focus>cost+action.aimed_shot.cost&active_enemies<4
actions.trickshots+=/kill_shot,if=buff.dead_eye.down
actions.trickshots+=/a_murder_of_crows
actions.trickshots+=/flayed_shot
actions.trickshots+=/serpent_sting,target_if=min:dot.serpent_sting.remains,if=refreshable
actions.trickshots+=/multishot,if=focus>cost+action.aimed_shot.cost
actions.trickshots+=/steady_shot

head=helm_of_insatiable_appetite,id=183001,bonus_id=7188/1485,ilevel=213
neck=nobles_birthstone_pendant,id=183039,bonus_id=7188/1485,ilevel=213
shoulders=boneshatter_pauldrons,id=172327,bonus_id=7003,ilevel=235
back=crest_of_the_legionnaire_general,id=183032,bonus_id=6805,ilevel=220
chest=master_huntsmans_bandolier,id=182988,bonus_id=6805,ilevel=213,enchant=eternal_skirmish
wrists=bangles_of_errant_pride,id=182977,bonus_id=6805,ilevel=213
hands=oathsworn_soldiers_gauntlets,id=182991,bonus_id=6805,ilevel=220
waist=loadbearing_belt,id=183016,bonus_id=6805,ilevel=213
legs=greaves_of_enigmatic_energies,id=183012,bonus_id=6805,ilevel=213
feet=stoneclas_stompers,id=183006,bonus_id=6805,ilevel=213,enchant=15agility
finger1=most_regal_signet_of_sire_denathrius,id=183036,bonus_id=6805,ilevel=220,enchant=16crit
finger2=ritualists_treasured_ring,id=183037,bonus_id=6805,ilevel=213,enchant=16crit
trinket1=dreadfire_vessel,id=184030,bonus_id=6805,ilevel=220,enchant=shadowcore_oil
trinket2=stone_legion_heraldry,id=184027,bonus_id=6805,ilevel=220
main_hand=deadeye_blunderbuss,id=184250,bonus_id=6805,ilevel=220,enchant=sinful_revelation

# Gear Summary
# gear_ilvl=217.27
# gear_agility=789
# gear_stamina=1300
# gear_crit_rating=443
# gear_haste_rating=604
# gear_mastery_rating=504
# gear_versatility_rating=54
# gear_armor=818

eagle_true_focus : 11441 dps, 3841 dps to main target

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
11441.3 11441.3 22.2 / 0.194% 1528.1 / 13.4% 1217.6
RPS Out RPS In Primary Resource Waiting APM Active Skill
9.4 9.2 Focus 0.00% 47.4 100.0% 100%
Talents
Night Fae
Runeforge

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
eagle_true_focus 11441
Aimed Shot 4193 (4587) 36.6% (40.1%) 53.3 5.60sec 25756 17144 Direct 266.1 (291.0) 3847 7692 4715 22.6% (22.5%)

Stats Details: Aimed Shot

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 53.28 266.06 0.00 0.00 1.5024 0.0000 1254432.69 1791831.66 29.99% 17143.89 17143.89
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 77.43% 206.01 149 263 3847.03 2524 9967 3850.13 3641 4100 792518 1132032 29.99%
crit 22.57% 60.05 36 87 7691.93 5048 19934 7696.65 6524 9406 461915 659799 29.99%

Action Details: Aimed Shot

  • id:19434
  • school:physical
  • range:40.0
  • travel_speed:100.0000
  • radius:8.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:12.000
  • cooldown hasted:true
  • base_recharge_multiplier:1.000
  • base_execute_time:2.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:focus
  • base_cost:35.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:19434
  • name:Aimed Shot
  • school:physical
  • tooltip:
  • description:A powerful aimed shot that deals {$s1=0} Physical damage.

Action Priority List

    trickshots
    [J]:53.52
  • if_expr:buff.trick_shots.remains>=execute_time&(buff.precise_shots.down|full_recharge_time<cast_time+gcd|buff.trueshot.up)
  • target_if_expr:(dot.serpent_sting.remains<?action.serpent_sting.in_flight_to_target*dot.serpent_sting.duration)
    Aimed Shot (_double_tap) 394 3.4% 0.0 0.00sec 0 0 Direct 24.9 3873 7681 4723 22.3%

Stats Details: Aimed Shot Double Tap

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 0.00 24.93 0.00 0.00 0.0000 0.0000 117746.82 168189.56 29.99% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 77.69% 19.37 7 29 3873.25 2524 9967 3899.68 3196 5419 75040 107187 29.99%
crit 22.31% 5.56 0 14 7681.16 5048 19934 7651.49 0 18806 42707 61002 29.79%

Action Details: Aimed Shot Double Tap

  • id:19434
  • school:physical
  • range:40.0
  • travel_speed:100.0000
  • radius:8.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:12.000
  • cooldown hasted:true
  • base_recharge_multiplier:1.000
  • base_execute_time:2.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:focus
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:19434
  • name:Aimed Shot
  • school:physical
  • tooltip:
  • description:A powerful aimed shot that deals {$s1=0} Physical damage.
Auto Shot 373 3.3% 112.5 2.68sec 993 434 Direct 112.2 811 1622 995 22.7%

Stats Details: Auto Shot

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 112.45 112.23 0.00 0.00 2.2865 0.0000 111692.29 159541.27 29.99% 434.40 434.40
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 77.32% 86.78 58 117 811.25 774 1019 811.18 796 826 70402 100562 29.99%
crit 22.68% 25.45 12 42 1622.37 1548 2037 1622.37 1563 1708 41290 58979 29.99%

Action Details: Auto Shot

  • id:75
  • school:physical
  • range:40.0
  • travel_speed:60.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00

Spelldata

  • id:75
  • name:Auto Shot
  • school:physical
  • tooltip:Firing at the target.
  • description:Automatically shoots the target until cancelled.
Dreadfire Vessel 137 1.2% 3.7 90.71sec 11027 0 Direct 3.7 9038 18092 11074 22.3%

Stats Details: Dreadfire Vessel

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 3.73 3.72 0.00 0.00 0.0000 0.0000 41164.42 41164.42 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 77.66% 2.89 0 4 9037.95 8937 9474 9001.03 0 9474 26120 26120 0.00%
crit 22.34% 0.83 0 4 18091.64 17875 18947 11015.16 0 18947 15044 15044 0.00%

Action Details: Dreadfire Vessel

  • id:344732
  • school:fire
  • range:50.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:90.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:8212.26
  • base_dd_max:8212.26
  • base_dd_mult:1.00

Spelldata

  • id:344732
  • name:Dreadfire Vessel
  • school:fire
  • tooltip:
  • description:Unleash incendiary flames at your target inflicting {$s1=0} Fire damage.
Eternal Skirmish 40 0.3% 21.7 13.21sec 546 0 Direct 21.7 446 892 546 22.5%

Stats Details: Eternal Skirmish

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 21.70 21.70 0.00 0.00 0.0000 0.0000 11857.77 11857.77 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 77.50% 16.82 7 32 446.00 435 485 445.99 435 460 7501 7501 0.00%
crit 22.50% 4.88 0 13 892.13 871 969 885.46 0 969 4356 4356 0.00%

Action Details: Eternal Skirmish

  • id:323889
  • school:shadow
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:400.00
  • base_dd_max:400.00
  • base_dd_mult:1.00

Spelldata

  • id:323889
  • name:Eternal Skirmish
  • school:shadow
  • tooltip:
  • description:Deals {$s1=400} Shadow damage.
Kill Shot 72 0.6% 4.0 14.54sec 5401 4488 Direct 4.0 4215 9470 5430 23.1%

Stats Details: Kill Shot

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 4.02 4.00 0.00 0.00 1.2037 0.0000 21737.79 31050.25 29.99% 4487.57 4487.57
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 76.86% 3.08 0 7 4215.15 4065 4796 4157.05 0 4552 12967 18522 29.72%
crit 23.14% 0.93 0 4 9469.85 9146 10792 6039.07 0 10792 8771 12528 19.15%

Action Details: Kill Shot

  • id:53351
  • school:physical
  • range:40.0
  • travel_speed:80.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:10.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:focus
  • base_cost:10.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:53351
  • name:Kill Shot
  • school:physical
  • tooltip:
  • description:You attempt to finish off a wounded target, dealing {$s1=0} Physical damage. Only usable on enemies with less than {$s2=20}% health.

Action Priority List

    trickshots
    [M]:4.01
  • if_expr:buff.dead_eye.down
Master Marksman 518 4.5% 302.8 1.00sec 513 0 Periodic 525.8 295 0 295 0.0% 70.1%

Stats Details: Master Marksman

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 302.75 0.00 525.80 525.80 0.0000 2.0000 155286.08 155286.08 0.00% 147.67 0.00
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 100.00% 525.80 385 653 295.45 37 3035 295.53 242 355 155286 155286 0.00%

Action Details: Master Marksman

  • id:269576
  • school:physical
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:false
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:6.00
  • base_tick_time:2.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH

Spelldata

  • id:269576
  • name:Master Marksman
  • school:physical
  • tooltip:Bleeding for $w1 damage every $t1 sec.
  • description:{$@spelldesc260309=Your ranged special attack critical strikes cause the target to bleed for an additional {$s1=15}% of the damage dealt over {$269576d=6 seconds}.}
Multi-Shot 2967 26.0% 89.7 3.33sec 9907 8629 Direct 447.5 1619 3237 1986 22.7%

Stats Details: Multishot

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 89.70 447.52 0.00 0.00 1.1481 0.0000 888616.52 1269299.84 29.99% 8629.19 8629.19
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 77.31% 345.99 262 422 1618.69 953 2194 1618.77 1524 1724 560020 799932 29.99%
crit 22.69% 101.53 60 141 3236.59 1905 4389 3236.42 2969 3477 328597 469367 29.99%

Action Details: Multishot

  • id:257620
  • school:physical
  • range:40.0
  • travel_speed:50.0000
  • radius:10.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:5
  • harmful:true

Resources

  • resource:focus
  • base_cost:20.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:257620
  • name:Multi-Shot
  • school:physical
  • tooltip:
  • description:Fires several missiles, hitting your current target and up to $I enemies within $A1 yards for {$s1=0} Physical damage.

Action Priority List

    trickshots
    [L]:79.12
  • if_expr:buff.trick_shots.down|buff.precise_shots.up&focus>cost+action.aimed_shot.cost&(!talent.chimaera_shot|active_enemies>3)
    trickshots
    [N]:10.59
  • if_expr:focus>cost+action.aimed_shot.cost
Rapid Fire 972 8.5% 15.0 19.51sec 19458 10858 Periodic 539.7 441 880 540 22.6% 1.5%

Stats Details: Rapid Fire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 14.98 0.00 108.31 539.66 1.7920 0.2129 291389.42 416220.65 29.99% 10858.15 10858.15
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 77.38% 417.60 275 568 440.57 351 925 440.48 421 458 183983 262802 29.99%
crit 22.62% 122.06 72 192 879.80 703 1850 879.89 793 953 107406 153419 29.99%

Action Details: Rapid Fire

  • id:257044
  • school:physical
  • range:40.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:20.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:false
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:2.00
  • base_tick_time:0.33
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH

Spelldata

  • id:257044
  • name:Rapid Fire
  • school:physical
  • tooltip:Being targeted by Rapid Fire.
  • description:Shoot a stream of {$s1=7} shots at your target over {$d=2 seconds}, dealing a total of ${$m1*$257045sw1} Physical damage. {$?s321281=true}[ Each shot generates {$263585s1=1} Focus.][] Usable while moving.

Action Details: Rapid Fire Damage

  • id:257045
  • school:physical
  • range:40.0
  • travel_speed:40.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:on_hit
  • energize_resource:focus
  • energize_amount:1.0

Spelldata

  • id:257045
  • name:Rapid Fire
  • school:physical
  • tooltip:
  • description:{$@spelldesc257044=Shoot a stream of {$s1=7} shots at your target over {$d=2 seconds}, dealing a total of ${$m1*$257045sw1} Physical damage. {$?s321281=true}[ Each shot generates {$263585s1=1} Focus.][] Usable while moving.}

Action Priority List

    trickshots
    [K]:14.97
  • if_expr:buff.trick_shots.remains>=execute_time
Shadowcore Oil Blast 43 0.4% 43.0 6.85sec 302 0 Direct 43.0 245 491 302 22.9%

Stats Details: Shadowcore Oil Blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 43.02 43.02 0.00 0.00 0.0000 0.0000 12975.88 12975.88 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 77.10% 33.17 18 52 245.44 239 266 245.45 242 251 8140 8140 0.00%
crit 22.90% 9.85 1 21 490.93 479 533 490.99 479 513 4836 4836 0.00%

Action Details: Shadowcore Oil Blast

  • id:336463
  • school:shadow
  • range:60.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:220.00
  • base_dd_max:220.00
  • base_dd_mult:1.00

Spelldata

  • id:336463
  • name:Shadowcore Oil Blast
  • school:shadow
  • tooltip:
  • description:Deals {$s1=220} Shadow damage.
Steady Shot 284 2.5% 55.0 5.42sec 1549 1130 Direct 55.9 1243 2485 1524 22.6%

Stats Details: Steady Shot

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 55.00 55.91 0.00 0.00 1.3713 0.0000 85205.63 121707.72 29.99% 1129.66 1129.66
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 77.37% 43.25 28 63 1242.64 1219 1451 1242.12 1221 1274 53752 76779 29.99%
crit 22.63% 12.65 4 25 2485.39 2439 2903 2484.25 2439 2601 31454 44929 29.99%

Action Details: Steady Shot

  • id:56641
  • school:physical
  • range:40.0
  • travel_speed:75.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:1.75
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:on_cast
  • energize_resource:focus
  • energize_amount:10.0

Spelldata

  • id:56641
  • name:Steady Shot
  • school:physical
  • tooltip:
  • description:A steady shot that causes {$s1=0} Physical damage. Usable while moving.{$?s321018=true}[ |cFFFFFFFFGenerates {$s2=0} Focus.][]

Action Priority List

    trickshots
    [F]:13.05
  • if_expr:talent.steady_focus&in_flight&buff.steady_focus.remains<5
    trickshots
    [O]:42.18
Wild Spirits 50 (1449) 0.4% (12.6%) 3.0 120.56sec 144853 131942 Direct 14.8 (240.8) 808 1614 990 22.7% (22.5%)

Stats Details: Wild Spirits

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.98 14.84 0.00 0.00 1.0981 0.0000 14693.93 14693.93 0.00% 131942.20 131942.20
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 77.35% 11.47 4 15 807.84 776 910 808.00 776 835 9270 9270 0.00%
crit 22.65% 3.36 0 11 1613.96 1552 1820 1573.06 0 1820 5424 5424 0.00%

Action Details: Wild Spirits

  • id:328231
  • school:nature
  • range:40.0
  • travel_speed:30.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:120.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:328231
  • name:Wild Spirits
  • school:nature
  • tooltip:
  • description:Evoke the energy of Wild Spirits at the target location, dealing {$328837s3=0} Nature damage and apply Hunter's Mark to all enemy targets within the area for {$328837d=15 seconds}. While the Wild Spirits are active, each damaging ability you or your pet use against a target in the area will strike up to $328757I nearby targets for {$328757s1=0} Nature damage.

Action Details: Wild Spirits Damage

  • id:328837
  • school:nature
  • range:100.0
  • travel_speed:0.0000
  • radius:12.0
  • trigger_gcd:0.0000
  • gcd_type:attack_haste
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:328837
  • name:Wild Spirits
  • school:nature
  • tooltip:
  • description:{$@spelldesc328231=Evoke the energy of Wild Spirits at the target location, dealing {$328837s3=0} Nature damage and apply Hunter's Mark to all enemy targets within the area for {$328837d=15 seconds}. While the Wild Spirits are active, each damaging ability you or your pet use against a target in the area will strike up to $328757I nearby targets for {$328757s1=0} Nature damage.}

Action Priority List

    trickshots
    [H]:2.98
    Wild Spirits (_proc) 1400 12.2% 45.2 5.68sec 9223 0 Direct 226.0 1506 3011 1845 22.5%

Stats Details: Wild Spirits Proc

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 45.20 226.00 0.00 0.00 0.0000 0.0000 416889.01 416889.01 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 77.49% 175.12 110 199 1505.71 1355 1699 1506.36 1487 1542 263695 263695 0.00%
crit 22.51% 50.88 26 77 3010.98 2711 3398 3012.11 2943 3117 153194 153194 0.00%

Action Details: Wild Spirits Proc

  • id:328757
  • school:nature
  • range:40.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:attack_haste
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:5
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:328757
  • name:Wild Spirits
  • school:nature
  • tooltip:
  • description:{$@spelldesc328231=Evoke the energy of Wild Spirits at the target location, dealing {$328837s3=0} Nature damage and apply Hunter's Mark to all enemy targets within the area for {$328837d=15 seconds}. While the Wild Spirits are active, each damaging ability you or your pet use against a target in the area will strike up to $328757I nearby targets for {$328757s1=0} Nature damage.}
Simple Action Stats Execute Interval
eagle_true_focus
Veiled Augmentation (augmentation) 1.0 0.00sec

Stats Details: Augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Augmentation

  • id:347901
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:eagle_true_focus
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Blood Fury 3.0 120.68sec

Stats Details: Blood Fury

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.97 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Blood Fury

  • id:20572
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:120.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:20572
  • name:Blood Fury
  • school:physical
  • tooltip:Attack power increased by $w1.
  • description:Increases your attack power by {$s1=122} for {$d=15 seconds}.

Action Priority List

    cds
    [D]:2.97
  • if_expr:buff.trueshot.up|target.time_to_die<16
Double Tap 5.6 60.64sec

Stats Details: Double Tap

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 5.60 0.00 0.00 0.00 0.9775 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Double Tap

  • id:260402
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:60.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:260402
  • name:Double Tap
  • school:physical
  • tooltip:Your next Aimed Shot will fire a second time instantly at {$s4=100}% power and consume no Focus, or your next Rapid Fire will shoot {$s3=100}% additional shots during its channel.
  • description:Your next Aimed Shot will fire a second time instantly at {$s4=100}% power without consuming Focus, or your next Rapid Fire will shoot {$s3=100}% additional shots during its channel.

Action Priority List

    trickshots
    [G]:4.60
  • if_expr:covenant.kyrian&cooldown.resonating_arrow.remains<gcd|cooldown.rapid_fire.remains<cooldown.aimed_shot.full_recharge_time|!(talent.streamline&runeforge.surging_shots)|!covenant.kyrian
Spectral Flask of Power (flask) 1.0 0.00sec

Stats Details: Flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Flask

  • id:307185
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:eagle_true_focus
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Feast of Gluttonous Hedonism (food) 1.0 0.00sec

Stats Details: Food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Food

  • id:308462
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:eagle_true_focus
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Potion of Spectral Agility (potion) 1.5 309.75sec

Stats Details: Potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.48 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Potion

  • id:307159
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:300.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Action Priority List

    cds
    [E]:1.47
  • if_expr:buff.trueshot.up&buff.bloodlust.up|buff.trueshot.up&target.health.pct<20|target.time_to_die<26
Trueshot 3.0 120.70sec

Stats Details: Trueshot

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.97 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Trueshot

  • id:288613
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:attack_haste
  • min_gcd:0.0000
  • cooldown:120.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:288613
  • name:Trueshot
  • school:physical
  • tooltip:The cooldown of Aimed Shot and Rapid Fire is reduced by ${$m1/4}%, and Aimed Shot casts {$s4=50}% faster. All Focus generation is increased by {$s5=50}%.
  • description:Reduces the cooldown of your Aimed Shot and Rapid Fire by ${$m1/4}%, and causes Aimed Shot to cast {$s4=50}% faster for {$d=15 seconds}. While Trueshot is active, you generate {$s5=50}% additional Focus.

Action Priority List

    trickshots
    [I]:2.97

Buffs

Dynamic Buffs Start Refresh Interval Trigger Avg Dur Up-Time Benefit Overflow Expiry
Blood Fury 3.0 0.0 120.7sec 120.7sec 14.7sec 14.64% 0.00% 0.0 (0.0) 2.8

Buff Details

  • buff initial source:eagle_true_focus
  • cooldown name:buff_blood_fury
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:120.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:attack_power
  • amount:122.00

Trigger Details

  • interval_min/max:120.0s / 122.9s
  • trigger_min/max:120.0s / 122.9s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 15.0s

Stack Uptimes

  • blood_fury_1:14.64%

Spelldata

  • id:20572
  • name:Blood Fury
  • tooltip:Attack power increased by $w1.
  • description:Increases your attack power by {$s1=122} for {$d=15 seconds}.
  • max_stacks:0
  • duration:15.00
  • cooldown:120.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 40.0sec 13.52% 0.00% 0.0 (0.0) 1.0

Buff Details

  • buff initial source:eagle_true_focus
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • base duration:40.00
  • duration modifier:1.00
  • base cooldown:300.00
  • default_chance:100.00%
  • default_value:0.30
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:40.0s / 40.0s

Stack Uptimes

  • bloodlust_1:13.52%

Spelldata

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by $w1%.
  • description:Increases haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Double Tap 5.6 0.0 58.5sec 60.6sec 4.7sec 8.90% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:eagle_true_focus
  • cooldown name:buff_double_tap
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.50
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:50.0s / 62.7s
  • trigger_min/max:60.0s / 62.7s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 11.2s

Stack Uptimes

  • double_tap_1:8.90%

Spelldata

  • id:260402
  • name:Double Tap
  • tooltip:Your next Aimed Shot will fire a second time instantly at {$s4=100}% power and consume no Focus, or your next Rapid Fire will shoot {$s3=100}% additional shots during its channel.
  • description:Your next Aimed Shot will fire a second time instantly at {$s4=100}% power without consuming Focus, or your next Rapid Fire will shoot {$s3=100}% additional shots during its channel.
  • max_stacks:0
  • duration:15.00
  • cooldown:60.00
  • default_chance:0.00%
Eagletalon's True Focus 3.0 0.0 120.7sec 120.7sec 19.1sec 18.99% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:eagle_true_focus
  • cooldown name:buff_eagletalons_true_focus
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.50
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:120.0s / 122.9s
  • trigger_min/max:120.0s / 122.9s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 19.7s

Stack Uptimes

  • eagletalons_true_focus_1:18.99%

Spelldata

  • id:336851
  • name:Eagletalon's True Focus
  • tooltip:Focus cost of all abilities reduced by {$s1=50}%.
  • description:{$@spelldesc336849=Trueshot also reduces the Focus cost of all of your abilities by {$336851s1=50}%.}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%

Trigger Spelldata

  • id:336849
  • name:Eagletalon's True Focus
  • tooltip:
  • description:Trueshot also reduces the Focus cost of all of your abilities by {$336851s1=50}%.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:101.00%
Well Fed (feast_of_gluttonous_hedonism) 1.0 0.0 0.0sec 0.0sec 300.0sec 100.00% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:eagle_true_focus
  • cooldown name:buff_feast_of_gluttonous_hedonism
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:agility
  • amount:20.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:240.1s / 359.8s

Stack Uptimes

  • feast_of_gluttonous_hedonism_1:100.00%

Spelldata

  • id:327709
  • name:Well Fed
  • tooltip:Agility increased by $w1.
  • description:Agility increased by {$s1=20}. Lasts {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Lock and Load 8.7 0.2 30.7sec 30.0sec 1.7sec 5.06% 16.06% 0.2 (0.2) 0.0

Buff Details

  • buff initial source:eagle_true_focus
  • cooldown name:buff_lock_and_load
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:8.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:1.8s / 270.9s
  • trigger_min/max:1.8s / 270.9s
  • trigger_pct:7.93%
  • duration_min/max:0.0s / 10.1s

Stack Uptimes

  • lock_and_load_1:5.06%

Spelldata

  • id:194594
  • name:Lock and Load
  • tooltip:Aimed Shot costs no Focus and is instant.
  • description:{$@spelldesc194595=Your ranged auto attacks have a {$194595h=8}% chance to trigger Lock and Load, causing your next Aimed Shot to cost no Focus and be instant.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%

Trigger Spelldata

  • id:194595
  • name:Lock and Load
  • tooltip:
  • description:Your ranged auto attacks have a {$194595h=8}% chance to trigger Lock and Load, causing your next Aimed Shot to cost no Focus and be instant.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:8.00%
Potion of Spectral Agility 1.5 0.0 309.3sec 309.3sec 23.3sec 11.25% 0.00% 0.0 (0.0) 1.2

Buff Details

  • buff initial source:eagle_true_focus
  • cooldown name:buff_potion_of_spectral_agility
  • max_stacks:1
  • base duration:25.00
  • duration modifier:1.00
  • base cooldown:1.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:agility
  • amount:190.00

Trigger Details

  • interval_min/max:300.0s / 332.3s
  • trigger_min/max:300.0s / 332.3s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 25.0s

Stack Uptimes

  • potion_of_spectral_agility_1:11.25%

Spelldata

  • id:307159
  • name:Potion of Spectral Agility
  • tooltip:Agility increased by $w1.
  • description:Increases your Agility by {$s1=190} for {$d=25 seconds}.
  • max_stacks:0
  • duration:25.00
  • cooldown:1.00
  • default_chance:0.00%
Precise Shots 39.6 13.7 7.5sec 5.6sec 2.9sec 38.70% 80.96% 6.9 (6.9) 0.0

Buff Details

  • buff initial source:eagle_true_focus
  • cooldown name:buff_precise_shots
  • max_stacks:2
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.50
  • default_chance:101.00%
  • default_value:0.75
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.9s / 38.2s
  • trigger_min/max:0.9s / 14.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 34.8s

Stack Uptimes

  • precise_shots_1:34.75%
  • precise_shots_2:3.95%

Spelldata

  • id:260242
  • name:Precise Shots
  • tooltip:Damage of {$?s342049=false}[Chimaera Shot][Arcane Shot] or Multi-Shot increased by {$s1=75}%.
  • description:{$@spelldesc260240=Aimed Shot causes your next 1-{$260242u=2} {$?s342049=false}[Chimaera Shots][Arcane Shots] or Multi-Shots to deal {$260242s1=75}% more damage.}
  • max_stacks:2
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
Spectral Flask of Power 1.0 0.0 0.0sec 0.0sec 300.0sec 100.00% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:eagle_true_focus
  • cooldown name:buff_spectral_flask_of_power
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:agility
  • amount:70.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:240.1s / 359.8s

Stack Uptimes

  • spectral_flask_of_power_1:100.00%

Spelldata

  • id:307185
  • name:Spectral Flask of Power
  • tooltip:$pri increased by $w1.
  • description:Increases $pri by {$s1=70} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Steady Focus 7.0 13.6 44.9sec 14.7sec 34.2sec 79.91% 0.00% 13.6 (13.6) 6.2

Buff Details

  • buff initial source:eagle_true_focus
  • cooldown name:buff_steady_focus
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.07
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:15.0s / 131.7s
  • trigger_min/max:4.0s / 53.4s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 110.9s

Stack Uptimes

  • steady_focus_1:79.91%

Spelldata

  • id:193534
  • name:Steady Focus
  • tooltip:Haste increased by {$s1=7}%.
  • description:{$@spelldesc193533=Using Steady Shot twice in a row increases your Haste by {$193534s1=7}% for {$193534d=15 seconds}.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%

Trigger Spelldata

  • id:193533
  • name:Steady Focus
  • tooltip:
  • description:Using Steady Shot twice in a row increases your Haste by {$193534s1=7}% for {$193534d=15 seconds}.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
Trick Shots 69.1 20.6 4.3sec 3.3sec 4.0sec 91.38% 100.00% 20.6 (20.6) 0.0

Buff Details

  • buff initial source:eagle_true_focus
  • cooldown name:buff_trick_shots
  • max_stacks:1
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:1.8s / 12.4s
  • trigger_min/max:0.9s / 11.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 12.3s

Stack Uptimes

  • trick_shots_1:91.38%

Spelldata

  • id:257622
  • name:Trick Shots
  • tooltip:Your next Aimed Shot or Rapid Fire will ricochet and hit {$257621s1=5} additional targets for {$257621s4=50}% of normal damage.
  • description:{$@spelldesc257621=When Multi-Shot hits {$s2=3} or more targets, your next Aimed Shot or Rapid Fire will ricochet and hit up to {$s1=5} additional targets for {$s4=50}% of normal damage.}
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
Trueshot 3.0 0.0 120.7sec 120.7sec 19.1sec 18.99% 0.00% 0.0 (0.0) 2.8

Buff Details

  • buff initial source:eagle_true_focus
  • cooldown name:buff_trueshot
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.31
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.50
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:120.0s / 122.9s
  • trigger_min/max:120.0s / 122.9s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 19.7s

Stack Uptimes

  • trueshot_1:18.99%

Spelldata

  • id:288613
  • name:Trueshot
  • tooltip:The cooldown of Aimed Shot and Rapid Fire is reduced by ${$m1/4}%, and Aimed Shot casts {$s4=50}% faster. All Focus generation is increased by {$s5=50}%.
  • description:Reduces the cooldown of your Aimed Shot and Rapid Fire by ${$m1/4}%, and causes Aimed Shot to cast {$s4=50}% faster for {$d=15 seconds}. While Trueshot is active, you generate {$s5=50}% additional Focus.
  • max_stacks:0
  • duration:15.00
  • cooldown:120.00
  • default_chance:0.00%
Veiled Augmentation 1.0 0.0 0.0sec 0.0sec 300.0sec 100.00% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:eagle_true_focus
  • cooldown name:buff_veiled_augmentation
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:agility
  • amount:18.00
  • stat:strength
  • amount:18.00
  • stat:intellect
  • amount:18.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:240.1s / 359.8s

Stack Uptimes

  • veiled_augmentation_1:100.00%

Spelldata

  • id:347901
  • name:Veiled Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=18} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Wild Spirits 3.0 0.0 120.6sec 120.6sec 17.5sec 17.43% 0.00% 0.0 (0.0) 2.8

Buff Details

  • buff initial source:eagle_true_focus
  • cooldown name:buff_wild_spirits
  • max_stacks:1
  • base duration:18.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:120.0s / 122.7s
  • trigger_min/max:120.0s / 122.7s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 18.0s

Stack Uptimes

  • wild_spirits_1:17.43%

Spelldata

  • id:328837
  • name:Wild Spirits
  • tooltip:
  • description:{$@spelldesc328231=Evoke the energy of Wild Spirits at the target location, dealing {$328837s3=0} Nature damage and apply Hunter's Mark to all enemy targets within the area for {$328837d=15 seconds}. While the Wild Spirits are active, each damaging ability you or your pet use against a target in the area will strike up to $328757I nearby targets for {$328757s1=0} Nature damage.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
Windfury Totem 1.0 0.0 0.0sec 0.0sec 300.0sec 100.00% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:eagle_true_focus
  • cooldown name:buff_windfury_totem
  • max_stacks:1
  • base duration:900.00
  • duration modifier:1.00
  • base cooldown:0.50
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:240.1s / 359.8s

Stack Uptimes

  • windfury_totem_1:100.00%

Spelldata

  • id:327942
  • name:Windfury Totem
  • tooltip:Your auto-attacks have a {$h=10}% chance to instantly attack again.
  • description:{$@spelldesc8512=Summons a Windfury Totem with {$s1=5} health at the feet of the caster for {$d=120 seconds}. Party members within {$s2=30} yds have a {$327942h=10}% chance when they auto-attack to swing an extra time.}
  • max_stacks:0
  • duration:120.00
  • cooldown:0.00
  • default_chance:10.00%
Constant Buffs
Arcane Intellect

Buff Details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff Details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:15.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
Power Word: Fortitude

Buff Details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.$?$w2>0[ Magic damage taken reduced by $w2%.][]
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Procs, Uptimes & Benefits

Proc Count Min Max Interval Min Max
double_tap_aimed 5.0 2.0 7.0 63.9s 47.1s 247.8s
double_tap_rapid_fire 0.5 0.0 3.0 96.5s 55.9s 244.4s
Uptime Avg % Min Max Avg Dur Min Max
Focus Cap 1.28% 0.88% 2.45% 0.8s 0.0s 2.4s

Cooldown waste details

Seconds per ExecuteSeconds per Iteration
AbilityAverageMinimumMaximumAverageMinimumMaximum
Double Tap0.7810.0012.7023.0450.0518.333
Aimed Shot0.8210.0014.5802.7100.00016.538
Kill Shot5.0380.00236.71813.0530.00036.718
Wild Spirits0.7220.0012.7121.1930.0004.121
Trueshot0.7820.0012.9021.4610.2714.393
Rapid Fire3.3000.00124.90040.12615.13269.962

Resources

Gains Type Count Total Tot% Avg Overflow Ovr%
eagle_true_focus
steady_shot Focus 55.99 539.88 19.60% 9.64 20.00 3.57%
rapid_fire Focus 108.30 107.97 3.92% 1.00 0.33 0.31%
focus_regen Focus 596.10 1912.33 69.43% 3.21 32.31 1.66%
Trueshot Focus 172.30 194.27 7.05% 1.13 9.43 4.63%
Change Start Gain/s Loss/s Overflow (Total) End (Avg) Min Max
Focus 100.0 9.18 9.37 62.1 42.8 0.6 100.0
Usage Type Count Total Avg RPE APR
eagle_true_focus
aimed_shot Focus 53.3 1237.0 23.2 23.2 1109.3
kill_shot Focus 4.0 40.0 10.0 9.9 544.0
multishot Focus 89.7 1534.8 17.1 17.1 579.0

Statistics & Data Analysis

Fight Length
eagle_true_focus Fight Length
Count 1217
Mean 299.97
Minimum 240.10
Maximum 359.83
Spread ( max - min ) 119.74
Range [ ( max - min ) / 2 * 100% ] 19.96%
DPS
eagle_true_focus Damage Per Second
Count 1217
Mean 11441.28
Minimum 10424.94
Maximum 12612.33
Spread ( max - min ) 2187.39
Range [ ( max - min ) / 2 * 100% ] 9.56%
Standard Deviation 395.0756
5th Percentile 10815.63
95th Percentile 12103.94
( 95th Percentile - 5th Percentile ) 1288.31
Mean Distribution
Standard Deviation 11.3249
95.00% Confidence Interval ( 11419.08 - 11463.47 )
Normalized 95.00% Confidence Interval ( 99.81% - 100.19% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 46
0.1% Error 4581
0.1 Scale Factor Error with Delta=300 1333
0.05 Scale Factor Error with Delta=300 5330
0.01 Scale Factor Error with Delta=300 133243
Priority Target DPS
eagle_true_focus Priority Target Damage Per Second
Count 1217
Mean 3840.86
Minimum 3397.02
Maximum 4324.32
Spread ( max - min ) 927.30
Range [ ( max - min ) / 2 * 100% ] 12.07%
Standard Deviation 143.3797
5th Percentile 3613.39
95th Percentile 4087.81
( 95th Percentile - 5th Percentile ) 474.42
Mean Distribution
Standard Deviation 4.1100
95.00% Confidence Interval ( 3832.80 - 3848.91 )
Normalized 95.00% Confidence Interval ( 99.79% - 100.21% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 54
0.1% Error 5354
0.1 Scale Factor Error with Delta=300 176
0.05 Scale Factor Error with Delta=300 702
0.01 Scale Factor Error with Delta=300 17550
DPS(e)
eagle_true_focus Damage Per Second (Effective)
Count 1217
Mean 11441.28
Minimum 10424.94
Maximum 12612.33
Spread ( max - min ) 2187.39
Range [ ( max - min ) / 2 * 100% ] 9.56%
Damage
eagle_true_focus Damage
Count 1217
Mean 3423688.25
Minimum 2601237.99
Maximum 4059970.58
Spread ( max - min ) 1458732.59
Range [ ( max - min ) / 2 * 100% ] 21.30%
DTPS
eagle_true_focus Damage Taken Per Second
Count 1217
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
eagle_true_focus Healing Per Second
Count 1217
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
eagle_true_focus Healing Per Second (Effective)
Count 1217
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
eagle_true_focus Heal
Count 1217
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
eagle_true_focus Healing Taken Per Second
Count 1217
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
eagle_true_focus Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
eagle_true_focusTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
eagle_true_focus Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask
1 0.00 augmentation
2 0.00 food
3 0.00 snapshot_stats
Snapshot raid buffed stats before combat begins and pre-potting is done.
4 0.00 tar_trap,if=runeforge.soulforge_embers
5 0.00 double_tap,precast_time=10,if=!covenant.kyrian&(!talent.volley|active_enemies<2)
6 0.00 aimed_shot,if=active_enemies<3
7 0.00 steady_shot,if=active_enemies>2
Default action list Executed every time the actor is available.
# count action,conditions
8 1.00 auto_shot
0.00 counter_shot,line_cd=30,if=runeforge.sephuzs_proclamation|soulbind.niyas_tools_poison|(conduit.reversal_of_fortune&!runeforge.sephuzs_proclamation)
9 3.74 use_items
A 0.00 call_action_list,name=cds
B 0.00 call_action_list,name=st,if=active_enemies<3
C 0.00 call_action_list,name=trickshots,if=active_enemies>2
actions.cds
# count action,conditions
0.00 berserking,if=buff.trueshot.up|target.time_to_die<13
D 2.97 blood_fury,if=buff.trueshot.up|target.time_to_die<16
0.00 ancestral_call,if=buff.trueshot.up|target.time_to_die<16
0.00 fireblood,if=buff.trueshot.up|target.time_to_die<9
0.00 lights_judgment,if=buff.trueshot.down
0.00 bag_of_tricks,if=buff.trueshot.down
E 1.47 potion,if=buff.trueshot.up&buff.bloodlust.up|buff.trueshot.up&target.health.pct<20|target.time_to_die<26
actions.trickshots
# count action,conditions
F 13.05 steady_shot,if=talent.steady_focus&in_flight&buff.steady_focus.remains<5
G 4.60 double_tap,if=covenant.kyrian&cooldown.resonating_arrow.remains<gcd|cooldown.rapid_fire.remains<cooldown.aimed_shot.full_recharge_time|!(talent.streamline&runeforge.surging_shots)|!covenant.kyrian
0.00 tar_trap,if=runeforge.soulforge_embers&tar_trap.remains<gcd&cooldown.flare.remains<gcd
0.00 flare,if=tar_trap.up&runeforge.soulforge_embers
0.00 explosive_shot
H 2.98 wild_spirits
0.00 resonating_arrow
0.00 volley
0.00 barrage
I 2.97 trueshot
0.00 rapid_fire,if=buff.trick_shots.remains>=execute_time&runeforge.surging_shots&buff.double_tap.down
J 53.52 aimed_shot,target_if=min:(dot.serpent_sting.remains<?action.serpent_sting.in_flight_to_target*dot.serpent_sting.duration),if=buff.trick_shots.remains>=execute_time&(buff.precise_shots.down|full_recharge_time<cast_time+gcd|buff.trueshot.up)
0.00 death_chakram,if=focus+cast_regen<focus.max
K 14.97 rapid_fire,if=buff.trick_shots.remains>=execute_time
L 79.12 multishot,if=buff.trick_shots.down|buff.precise_shots.up&focus>cost+action.aimed_shot.cost&(!talent.chimaera_shot|active_enemies>3)
0.00 chimaera_shot,if=buff.precise_shots.up&focus>cost+action.aimed_shot.cost&active_enemies<4
M 4.01 kill_shot,if=buff.dead_eye.down
0.00 a_murder_of_crows
0.00 flayed_shot
0.00 serpent_sting,target_if=min:dot.serpent_sting.remains,if=refreshable
N 10.59 multishot,if=focus>cost+action.aimed_shot.cost
O 42.18 steady_shot

Sample Sequence

0125789FHIDELJLJLJLJLJLJLKLJLJLJLKLJLLJLOFLJLJLJOLOJLKLOFGJLOOLJLOOJLKLOONJLOOONNJLK9LOFJLOONONJLOKLGJLOFOLHIDJLKLJLJLJLJLJLJLJLKLJLOFJLONNONJLKLOFGJLOO9NNOJLKLOFJLOLONOJLOFKLJLOJLNOFJLONOKLJGLOFNHIDJLJLJLJLJLJLJLKLJLJLO9FNKLJLOMOFJLOOLMKGLJLOFLJLMOOLJLKLMOOJLEOOLJLMOJLKLJLMOFLJL

Sample Sequence Table

Time List # Name Target Resources Buffs
Pre precombat 0 flask eagle_true_focus 100.0/100: 100% focus
Pre precombat 1 augmentation eagle_true_focus 100.0/100: 100% focus
Pre precombat 2 food eagle_true_focus 100.0/100: 100% focus
Pre precombat 5 double_tap Fluffy_Pillow 100.0/100: 100% focus
Pre precombat 7 steady_shot Fluffy_Pillow 100.0/100: 100% focus double_tap
0:00.000 default 8 auto_attack Fluffy_Pillow 100.0/100: 100% focus double_tap
0:00.000 default 9 use_items Fluffy_Pillow 100.0/100: 100% focus double_tap
0:00.000 trickshots F steady_shot Fluffy_Pillow 100.0/100: 100% focus double_tap
0:01.483 trickshots H wild_spirits Fluffy_Pillow 100.0/100: 100% focus bloodlust, double_tap, steady_focus
0:02.398 trickshots I trueshot Fluffy_Pillow 100.0/100: 100% focus bloodlust, double_tap, steady_focus
0:02.398 cds D blood_fury Fluffy_Pillow 100.0/100: 100% focus bloodlust, double_tap, steady_focus, trueshot, eagletalons_true_focus
0:02.398 cds E potion Fluffy_Pillow 100.0/100: 100% focus bloodlust, blood_fury, double_tap, steady_focus, trueshot, eagletalons_true_focus
0:02.398 trickshots L multishot Fluffy_Pillow 100.0/100: 100% focus bloodlust, blood_fury, double_tap, steady_focus, trueshot, eagletalons_true_focus, potion_of_spectral_agility
0:03.314 trickshots J aimed_shot Fluffy_Pillow 100.0/100: 100% focus bloodlust, blood_fury, double_tap, lock_and_load, steady_focus, trick_shots, trueshot, wild_spirits, eagletalons_true_focus, potion_of_spectral_agility
0:04.228 trickshots L multishot Fluffy_Pillow 100.0/100: 100% focus bloodlust, blood_fury, precise_shots, steady_focus, trueshot, wild_spirits, eagletalons_true_focus, potion_of_spectral_agility
0:05.145 trickshots J aimed_shot Fluffy_Pillow 100.0/100: 100% focus bloodlust, blood_fury, steady_focus, trick_shots, trueshot, wild_spirits, eagletalons_true_focus, potion_of_spectral_agility
0:06.060 trickshots L multishot Fluffy_Pillow 83.9/100: 84% focus bloodlust, blood_fury, precise_shots, steady_focus, trueshot, wild_spirits, eagletalons_true_focus, potion_of_spectral_agility
0:06.975 trickshots J aimed_shot Fluffy_Pillow 85.2/100: 85% focus bloodlust, blood_fury, steady_focus, trick_shots, trueshot, wild_spirits, eagletalons_true_focus, potion_of_spectral_agility
0:07.890 trickshots L multishot Fluffy_Pillow 78.5/100: 79% focus bloodlust, blood_fury, precise_shots, steady_focus, trueshot, wild_spirits, eagletalons_true_focus, potion_of_spectral_agility
0:08.804 trickshots J aimed_shot Fluffy_Pillow 79.8/100: 80% focus bloodlust, blood_fury, steady_focus, trick_shots, trueshot, wild_spirits, eagletalons_true_focus, potion_of_spectral_agility
0:09.719 trickshots L multishot Fluffy_Pillow 73.1/100: 73% focus bloodlust, blood_fury, precise_shots, steady_focus, trueshot, wild_spirits, eagletalons_true_focus, potion_of_spectral_agility
0:10.633 trickshots J aimed_shot Fluffy_Pillow 74.4/100: 74% focus bloodlust, blood_fury, steady_focus, trick_shots, trueshot, wild_spirits, eagletalons_true_focus, potion_of_spectral_agility
0:11.549 trickshots L multishot Fluffy_Pillow 67.7/100: 68% focus bloodlust, blood_fury, precise_shots(2), steady_focus, trueshot, wild_spirits, eagletalons_true_focus, potion_of_spectral_agility
0:12.466 trickshots J aimed_shot Fluffy_Pillow 69.0/100: 69% focus bloodlust, blood_fury, precise_shots, steady_focus, trick_shots, trueshot, wild_spirits, eagletalons_true_focus, potion_of_spectral_agility
0:13.550 trickshots L multishot Fluffy_Pillow 64.4/100: 64% focus bloodlust, blood_fury, precise_shots(2), steady_focus, trueshot, wild_spirits, eagletalons_true_focus, potion_of_spectral_agility
0:14.464 trickshots K rapid_fire Fluffy_Pillow 65.6/100: 66% focus bloodlust, blood_fury, precise_shots, steady_focus, trick_shots, trueshot, wild_spirits, eagletalons_true_focus, potion_of_spectral_agility
0:15.864 trickshots L multishot Fluffy_Pillow 92.9/100: 93% focus bloodlust, blood_fury, precise_shots, steady_focus, trueshot, wild_spirits, eagletalons_true_focus, potion_of_spectral_agility
0:16.779 trickshots J aimed_shot Fluffy_Pillow 94.0/100: 94% focus bloodlust, blood_fury, trick_shots, trueshot, wild_spirits, eagletalons_true_focus, potion_of_spectral_agility
0:17.763 trickshots L multishot Fluffy_Pillow 84.0/100: 84% focus bloodlust, precise_shots(2), trueshot, wild_spirits, eagletalons_true_focus, potion_of_spectral_agility
0:18.744 trickshots J aimed_shot Fluffy_Pillow 85.3/100: 85% focus bloodlust, precise_shots, trick_shots, trueshot, wild_spirits, eagletalons_true_focus, potion_of_spectral_agility
0:19.722 trickshots L multishot Fluffy_Pillow 78.6/100: 79% focus bloodlust, precise_shots(2), trueshot, wild_spirits, eagletalons_true_focus, potion_of_spectral_agility
0:20.701 trickshots J aimed_shot Fluffy_Pillow 79.9/100: 80% focus bloodlust, precise_shots, trick_shots, trueshot, wild_spirits, eagletalons_true_focus, potion_of_spectral_agility
0:21.679 trickshots L multishot Fluffy_Pillow 73.2/100: 73% focus bloodlust, precise_shots(2), trueshot, eagletalons_true_focus, potion_of_spectral_agility
0:22.658 trickshots K rapid_fire Fluffy_Pillow 72.1/100: 72% focus bloodlust, precise_shots, trick_shots, potion_of_spectral_agility
0:24.136 trickshots L multishot Fluffy_Pillow 90.5/100: 90% focus bloodlust, precise_shots, potion_of_spectral_agility
0:25.117 trickshots J aimed_shot Fluffy_Pillow 78.0/100: 78% focus bloodlust, trick_shots, potion_of_spectral_agility
0:26.747 trickshots L multishot Fluffy_Pillow 55.5/100: 56% focus bloodlust, lock_and_load, precise_shots(2), potion_of_spectral_agility
0:27.725 trickshots L multishot Fluffy_Pillow 43.1/100: 43% focus bloodlust, lock_and_load, precise_shots, trick_shots
0:28.705 trickshots J aimed_shot Fluffy_Pillow 30.6/100: 31% focus bloodlust, lock_and_load, trick_shots
0:29.684 trickshots L multishot Fluffy_Pillow 38.1/100: 38% focus bloodlust, precise_shots(2)
0:30.662 trickshots O steady_shot Fluffy_Pillow 25.6/100: 26% focus bloodlust, precise_shots, trick_shots
0:31.804 trickshots F steady_shot Fluffy_Pillow 44.4/100: 44% focus bloodlust, precise_shots, trick_shots
0:32.944 trickshots L multishot Fluffy_Pillow 63.2/100: 63% focus bloodlust, lock_and_load, precise_shots, steady_focus, trick_shots
0:33.858 trickshots J aimed_shot Fluffy_Pillow 50.7/100: 51% focus bloodlust, lock_and_load, steady_focus, trick_shots
0:34.775 trickshots L multishot Fluffy_Pillow 58.3/100: 58% focus bloodlust, precise_shots, steady_focus
0:35.690 trickshots J aimed_shot Fluffy_Pillow 45.8/100: 46% focus bloodlust, steady_focus, trick_shots
0:37.212 trickshots L multishot Fluffy_Pillow 23.3/100: 23% focus bloodlust, lock_and_load, precise_shots, steady_focus
0:38.127 trickshots J aimed_shot Fluffy_Pillow 10.8/100: 11% focus bloodlust, lock_and_load, steady_focus, trick_shots
0:39.042 trickshots O steady_shot Fluffy_Pillow 18.4/100: 18% focus bloodlust, precise_shots, steady_focus
0:40.109 trickshots L multishot Fluffy_Pillow 37.2/100: 37% focus bloodlust, precise_shots, steady_focus
0:41.025 trickshots O steady_shot Fluffy_Pillow 24.6/100: 25% focus steady_focus, trick_shots
0:42.412 trickshots J aimed_shot Fluffy_Pillow 43.4/100: 43% focus steady_focus, trick_shots
0:44.390 trickshots L multishot Fluffy_Pillow 20.9/100: 21% focus precise_shots(2), steady_focus
0:45.579 trickshots K rapid_fire Fluffy_Pillow 8.5/100: 8% focus precise_shots, steady_focus, trick_shots
0:47.435 trickshots L multishot Fluffy_Pillow 27.2/100: 27% focus precise_shots, steady_focus
0:48.623 trickshots O steady_shot Fluffy_Pillow 14.4/100: 14% focus trick_shots
0:50.106 trickshots F steady_shot Fluffy_Pillow 33.2/100: 33% focus trick_shots
0:51.589 trickshots G double_tap Fluffy_Pillow 52.0/100: 52% focus steady_focus, trick_shots
0:52.776 trickshots J aimed_shot Fluffy_Pillow 59.5/100: 60% focus double_tap, steady_focus, trick_shots
0:54.755 trickshots L multishot Fluffy_Pillow 37.0/100: 37% focus precise_shots(2), steady_focus
0:55.944 trickshots O steady_shot Fluffy_Pillow 24.6/100: 25% focus precise_shots, steady_focus, trick_shots
0:57.330 trickshots O steady_shot Fluffy_Pillow 43.3/100: 43% focus precise_shots, steady_focus, trick_shots
0:58.716 trickshots L multishot Fluffy_Pillow 62.1/100: 62% focus precise_shots, steady_focus, trick_shots
0:59.905 trickshots J aimed_shot Fluffy_Pillow 49.6/100: 50% focus steady_focus, trick_shots
1:01.884 trickshots L multishot Fluffy_Pillow 27.2/100: 27% focus precise_shots, steady_focus
1:03.072 trickshots O steady_shot Fluffy_Pillow 14.7/100: 15% focus steady_focus, trick_shots
1:04.459 trickshots O steady_shot Fluffy_Pillow 33.5/100: 33% focus steady_focus, trick_shots
1:05.846 trickshots J aimed_shot Fluffy_Pillow 52.2/100: 52% focus steady_focus, trick_shots
1:07.919 trickshots L multishot Fluffy_Pillow 30.3/100: 30% focus precise_shots(2), steady_focus
1:09.107 trickshots K rapid_fire Fluffy_Pillow 17.9/100: 18% focus precise_shots, steady_focus, trick_shots
1:10.866 trickshots L multishot Fluffy_Pillow 36.0/100: 36% focus precise_shots, steady_focus
1:12.054 trickshots O steady_shot Fluffy_Pillow 23.5/100: 24% focus steady_focus, trick_shots
1:13.442 trickshots O steady_shot Fluffy_Pillow 42.3/100: 42% focus steady_focus, trick_shots
1:14.829 trickshots N multishot Fluffy_Pillow 61.1/100: 61% focus steady_focus, trick_shots
1:16.017 trickshots J aimed_shot Fluffy_Pillow 48.6/100: 49% focus steady_focus, trick_shots
1:17.996 trickshots L multishot Fluffy_Pillow 26.1/100: 26% focus precise_shots, steady_focus
1:19.185 trickshots O steady_shot Fluffy_Pillow 13.7/100: 14% focus steady_focus, trick_shots
1:20.572 trickshots O steady_shot Fluffy_Pillow 32.4/100: 32% focus steady_focus, trick_shots
1:21.958 trickshots O steady_shot Fluffy_Pillow 51.2/100: 51% focus steady_focus, trick_shots
1:23.342 trickshots N multishot Fluffy_Pillow 70.0/100: 70% focus steady_focus, trick_shots
1:24.530 trickshots N multishot Fluffy_Pillow 57.5/100: 57% focus steady_focus, trick_shots
1:25.720 trickshots J aimed_shot Fluffy_Pillow 45.0/100: 45% focus steady_focus, trick_shots
1:27.699 trickshots L multishot Fluffy_Pillow 22.5/100: 23% focus precise_shots(2), steady_focus
1:28.886 trickshots K rapid_fire Fluffy_Pillow 10.1/100: 10% focus precise_shots, steady_focus, trick_shots
1:31.059 default 9 use_items Fluffy_Pillow 30.8/100: 31% focus precise_shots, steady_focus
1:31.059 trickshots L multishot Fluffy_Pillow 30.8/100: 31% focus precise_shots, steady_focus
1:32.246 trickshots O steady_shot Fluffy_Pillow 18.3/100: 18% focus steady_focus, trick_shots
1:33.634 trickshots F steady_shot Fluffy_Pillow 37.1/100: 37% focus steady_focus, trick_shots
1:35.019 trickshots J aimed_shot Fluffy_Pillow 55.9/100: 56% focus steady_focus, trick_shots
1:36.999 trickshots L multishot Fluffy_Pillow 33.4/100: 33% focus precise_shots, steady_focus
1:38.189 trickshots O steady_shot Fluffy_Pillow 20.9/100: 21% focus steady_focus, trick_shots
1:39.574 trickshots O steady_shot Fluffy_Pillow 39.7/100: 40% focus steady_focus, trick_shots
1:40.960 trickshots N multishot Fluffy_Pillow 58.5/100: 58% focus steady_focus, trick_shots
1:42.148 trickshots O steady_shot Fluffy_Pillow 46.0/100: 46% focus steady_focus, trick_shots
1:43.536 trickshots N multishot Fluffy_Pillow 64.8/100: 65% focus steady_focus, trick_shots
1:44.726 trickshots J aimed_shot Fluffy_Pillow 52.3/100: 52% focus steady_focus, trick_shots
1:46.705 trickshots L multishot Fluffy_Pillow 29.8/100: 30% focus precise_shots, steady_focus
1:47.893 trickshots O steady_shot Fluffy_Pillow 17.4/100: 17% focus steady_focus, trick_shots
1:49.280 trickshots K rapid_fire Fluffy_Pillow 36.1/100: 36% focus steady_focus, trick_shots
1:50.990 trickshots L multishot Fluffy_Pillow 54.0/100: 54% focus steady_focus
1:52.179 trickshots G double_tap Fluffy_Pillow 41.5/100: 41% focus steady_focus, trick_shots
1:53.368 trickshots J aimed_shot Fluffy_Pillow 49.0/100: 49% focus double_tap, steady_focus, trick_shots
1:55.348 trickshots L multishot Fluffy_Pillow 26.5/100: 27% focus precise_shots(2), steady_focus
1:56.535 trickshots O steady_shot Fluffy_Pillow 13.8/100: 14% focus precise_shots, trick_shots
1:58.018 trickshots F steady_shot Fluffy_Pillow 32.6/100: 33% focus precise_shots, trick_shots
1:59.502 trickshots O steady_shot Fluffy_Pillow 51.4/100: 51% focus precise_shots, steady_focus, trick_shots
2:00.888 trickshots L multishot Fluffy_Pillow 70.1/100: 70% focus precise_shots, steady_focus, trick_shots
2:02.079 trickshots H wild_spirits Fluffy_Pillow 57.7/100: 58% focus steady_focus, trick_shots
2:03.267 trickshots I trueshot Fluffy_Pillow 65.2/100: 65% focus steady_focus, trick_shots
2:03.267 cds D blood_fury Fluffy_Pillow 65.2/100: 65% focus steady_focus, trick_shots, trueshot, eagletalons_true_focus
2:03.267 trickshots J aimed_shot Fluffy_Pillow 65.2/100: 65% focus blood_fury, steady_focus, trick_shots, trueshot, eagletalons_true_focus
2:04.454 trickshots L multishot Fluffy_Pillow 58.5/100: 58% focus blood_fury, precise_shots, steady_focus, trueshot, wild_spirits, eagletalons_true_focus
2:05.642 trickshots K rapid_fire Fluffy_Pillow 59.7/100: 60% focus blood_fury, steady_focus, trick_shots, trueshot, wild_spirits, eagletalons_true_focus
2:07.438 trickshots L multishot Fluffy_Pillow 89.8/100: 90% focus blood_fury, steady_focus, trueshot, wild_spirits, eagletalons_true_focus
2:08.626 trickshots J aimed_shot Fluffy_Pillow 91.1/100: 91% focus blood_fury, steady_focus, trick_shots, trueshot, wild_spirits, eagletalons_true_focus
2:09.814 trickshots L multishot Fluffy_Pillow 83.9/100: 84% focus blood_fury, precise_shots(2), steady_focus, trueshot, wild_spirits, eagletalons_true_focus
2:11.003 trickshots J aimed_shot Fluffy_Pillow 85.2/100: 85% focus blood_fury, precise_shots, steady_focus, trick_shots, trueshot, wild_spirits, eagletalons_true_focus
2:12.192 trickshots L multishot Fluffy_Pillow 78.5/100: 78% focus blood_fury, precise_shots(2), steady_focus, trueshot, wild_spirits, eagletalons_true_focus
2:13.380 trickshots J aimed_shot Fluffy_Pillow 79.8/100: 80% focus blood_fury, precise_shots, steady_focus, trick_shots, trueshot, wild_spirits, eagletalons_true_focus
2:14.568 trickshots L multishot Fluffy_Pillow 73.0/100: 73% focus blood_fury, precise_shots(2), trueshot, wild_spirits, eagletalons_true_focus
2:15.840 trickshots J aimed_shot Fluffy_Pillow 74.3/100: 74% focus blood_fury, lock_and_load, precise_shots, trick_shots, trueshot, wild_spirits, eagletalons_true_focus
2:17.112 trickshots L multishot Fluffy_Pillow 85.6/100: 86% focus blood_fury, precise_shots(2), trueshot, wild_spirits, eagletalons_true_focus
2:18.384 trickshots J aimed_shot Fluffy_Pillow 86.9/100: 87% focus precise_shots, trick_shots, trueshot, wild_spirits, eagletalons_true_focus
2:19.656 trickshots L multishot Fluffy_Pillow 80.1/100: 80% focus precise_shots(2), trueshot, wild_spirits, eagletalons_true_focus
2:20.927 trickshots J aimed_shot Fluffy_Pillow 81.4/100: 81% focus lock_and_load, precise_shots, trick_shots, trueshot, wild_spirits, eagletalons_true_focus
2:22.198 trickshots L multishot Fluffy_Pillow 92.7/100: 93% focus precise_shots(2), trueshot, eagletalons_true_focus
2:23.469 trickshots J aimed_shot Fluffy_Pillow 92.3/100: 92% focus precise_shots, trick_shots
2:25.585 trickshots L multishot Fluffy_Pillow 65.0/100: 65% focus lock_and_load, precise_shots(2)
2:26.857 trickshots K rapid_fire Fluffy_Pillow 52.5/100: 53% focus lock_and_load, precise_shots, trick_shots
2:28.867 trickshots L multishot Fluffy_Pillow 71.4/100: 71% focus lock_and_load, precise_shots
2:30.137 trickshots J aimed_shot Fluffy_Pillow 58.9/100: 59% focus lock_and_load, trick_shots
2:31.409 trickshots L multishot Fluffy_Pillow 66.5/100: 66% focus precise_shots
2:32.680 trickshots O steady_shot Fluffy_Pillow 54.0/100: 54% focus trick_shots
2:34.164 trickshots F steady_shot Fluffy_Pillow 72.8/100: 73% focus trick_shots
2:35.646 trickshots J aimed_shot Fluffy_Pillow 91.5/100: 92% focus steady_focus, trick_shots
2:37.697 trickshots L multishot Fluffy_Pillow 65.0/100: 65% focus precise_shots, steady_focus
2:38.886 trickshots O steady_shot Fluffy_Pillow 52.6/100: 53% focus steady_focus, trick_shots
2:40.272 trickshots N multishot Fluffy_Pillow 71.3/100: 71% focus steady_focus, trick_shots
2:41.459 trickshots N multishot Fluffy_Pillow 58.8/100: 59% focus steady_focus, trick_shots
2:42.647 trickshots O steady_shot Fluffy_Pillow 46.4/100: 46% focus steady_focus, trick_shots
2:44.034 trickshots N multishot Fluffy_Pillow 65.1/100: 65% focus steady_focus, trick_shots
2:45.221 trickshots J aimed_shot Fluffy_Pillow 52.6/100: 53% focus steady_focus, trick_shots
2:47.201 trickshots L multishot Fluffy_Pillow 30.2/100: 30% focus precise_shots, steady_focus
2:48.391 trickshots K rapid_fire Fluffy_Pillow 17.7/100: 18% focus steady_focus, trick_shots
2:50.203 trickshots L multishot Fluffy_Pillow 36.2/100: 36% focus steady_focus
2:51.391 trickshots O steady_shot Fluffy_Pillow 23.4/100: 23% focus trick_shots
2:52.877 trickshots F steady_shot Fluffy_Pillow 42.2/100: 42% focus trick_shots
2:54.362 trickshots G double_tap Fluffy_Pillow 61.0/100: 61% focus steady_focus, trick_shots
2:55.549 trickshots J aimed_shot Fluffy_Pillow 68.5/100: 68% focus double_tap, steady_focus, trick_shots
2:57.527 trickshots L multishot Fluffy_Pillow 46.0/100: 46% focus precise_shots, steady_focus
2:58.717 trickshots O steady_shot Fluffy_Pillow 33.5/100: 34% focus steady_focus, trick_shots
3:00.104 trickshots O steady_shot Fluffy_Pillow 52.3/100: 52% focus steady_focus, trick_shots
3:01.490 default 9 use_items Fluffy_Pillow 71.1/100: 71% focus steady_focus, trick_shots
3:01.490 trickshots N multishot Fluffy_Pillow 71.1/100: 71% focus steady_focus, trick_shots
3:02.678 trickshots N multishot Fluffy_Pillow 58.6/100: 59% focus steady_focus, trick_shots
3:03.865 trickshots O steady_shot Fluffy_Pillow 46.1/100: 46% focus steady_focus, trick_shots
3:05.251 trickshots J aimed_shot Fluffy_Pillow 64.9/100: 65% focus steady_focus, trick_shots
3:07.229 trickshots L multishot Fluffy_Pillow 42.4/100: 42% focus precise_shots(2), steady_focus
3:08.417 trickshots K rapid_fire Fluffy_Pillow 29.9/100: 30% focus precise_shots, steady_focus, trick_shots
3:10.209 trickshots L multishot Fluffy_Pillow 48.3/100: 48% focus precise_shots, steady_focus
3:11.397 trickshots O steady_shot Fluffy_Pillow 35.8/100: 36% focus steady_focus, trick_shots
3:12.783 trickshots F steady_shot Fluffy_Pillow 54.6/100: 55% focus steady_focus, trick_shots
3:14.171 trickshots J aimed_shot Fluffy_Pillow 73.3/100: 73% focus steady_focus, trick_shots
3:16.151 trickshots L multishot Fluffy_Pillow 50.9/100: 51% focus precise_shots(2), steady_focus
3:17.339 trickshots O steady_shot Fluffy_Pillow 38.4/100: 38% focus precise_shots, steady_focus, trick_shots
3:18.725 trickshots L multishot Fluffy_Pillow 57.2/100: 57% focus precise_shots, steady_focus, trick_shots
3:19.913 trickshots O steady_shot Fluffy_Pillow 44.7/100: 45% focus steady_focus, trick_shots
3:21.300 trickshots N multishot Fluffy_Pillow 63.5/100: 63% focus steady_focus, trick_shots
3:22.487 trickshots O steady_shot Fluffy_Pillow 51.0/100: 51% focus steady_focus, trick_shots
3:23.874 trickshots J aimed_shot Fluffy_Pillow 69.8/100: 70% focus steady_focus, trick_shots
3:25.852 trickshots L multishot Fluffy_Pillow 47.3/100: 47% focus precise_shots(2), steady_focus
3:27.042 trickshots O steady_shot Fluffy_Pillow 34.8/100: 35% focus precise_shots, steady_focus, trick_shots
3:28.428 trickshots F steady_shot Fluffy_Pillow 53.6/100: 54% focus precise_shots, steady_focus, trick_shots
3:29.815 trickshots K rapid_fire Fluffy_Pillow 72.1/100: 72% focus precise_shots, steady_focus, trick_shots
3:31.630 trickshots L multishot Fluffy_Pillow 90.6/100: 91% focus precise_shots, steady_focus
3:32.820 trickshots J aimed_shot Fluffy_Pillow 78.1/100: 78% focus steady_focus, trick_shots
3:34.854 trickshots L multishot Fluffy_Pillow 56.0/100: 56% focus precise_shots, steady_focus
3:36.043 trickshots O steady_shot Fluffy_Pillow 43.5/100: 44% focus steady_focus, trick_shots
3:37.431 trickshots J aimed_shot Fluffy_Pillow 62.3/100: 62% focus lock_and_load, steady_focus, trick_shots
3:38.621 trickshots L multishot Fluffy_Pillow 69.8/100: 70% focus precise_shots, steady_focus
3:39.810 trickshots N multishot Fluffy_Pillow 57.3/100: 57% focus steady_focus, trick_shots
3:40.997 trickshots O steady_shot Fluffy_Pillow 44.9/100: 45% focus steady_focus, trick_shots
3:42.385 trickshots F steady_shot Fluffy_Pillow 63.6/100: 64% focus steady_focus, trick_shots
3:43.772 trickshots J aimed_shot Fluffy_Pillow 82.4/100: 82% focus steady_focus, trick_shots
3:45.751 trickshots L multishot Fluffy_Pillow 59.9/100: 60% focus precise_shots, steady_focus
3:46.941 trickshots O steady_shot Fluffy_Pillow 47.5/100: 47% focus steady_focus, trick_shots
3:48.327 trickshots N multishot Fluffy_Pillow 66.3/100: 66% focus steady_focus, trick_shots
3:49.517 trickshots O steady_shot Fluffy_Pillow 53.8/100: 54% focus steady_focus, trick_shots
3:50.902 trickshots K rapid_fire Fluffy_Pillow 72.6/100: 73% focus steady_focus, trick_shots
3:52.652 trickshots L multishot Fluffy_Pillow 90.6/100: 91% focus steady_focus
3:53.842 trickshots J aimed_shot Fluffy_Pillow 78.2/100: 78% focus steady_focus, trick_shots
3:55.820 trickshots G double_tap Fluffy_Pillow 55.7/100: 56% focus precise_shots, steady_focus
3:57.009 trickshots L multishot Fluffy_Pillow 63.2/100: 63% focus double_tap, precise_shots, steady_focus
3:58.199 trickshots O steady_shot Fluffy_Pillow 50.7/100: 51% focus double_tap, steady_focus, trick_shots
3:59.587 trickshots F steady_shot Fluffy_Pillow 69.2/100: 69% focus double_tap, trick_shots
4:01.071 trickshots N multishot Fluffy_Pillow 88.0/100: 88% focus double_tap, steady_focus, trick_shots
4:02.260 trickshots H wild_spirits Fluffy_Pillow 75.5/100: 75% focus double_tap, steady_focus, trick_shots
4:03.448 trickshots I trueshot Fluffy_Pillow 83.0/100: 83% focus double_tap, lock_and_load, steady_focus, trick_shots
4:03.448 cds D blood_fury Fluffy_Pillow 83.0/100: 83% focus double_tap, lock_and_load, steady_focus, trick_shots, trueshot, eagletalons_true_focus
4:03.448 trickshots J aimed_shot Fluffy_Pillow 83.0/100: 83% focus blood_fury, double_tap, lock_and_load, steady_focus, trick_shots, trueshot, eagletalons_true_focus
4:04.638 trickshots L multishot Fluffy_Pillow 94.3/100: 94% focus blood_fury, precise_shots(2), steady_focus, trueshot, wild_spirits, eagletalons_true_focus
4:05.827 trickshots J aimed_shot Fluffy_Pillow 95.6/100: 96% focus blood_fury, precise_shots, steady_focus, trick_shots, trueshot, wild_spirits, eagletalons_true_focus
4:07.015 trickshots L multishot Fluffy_Pillow 83.9/100: 84% focus blood_fury, precise_shots(2), steady_focus, trueshot, wild_spirits, eagletalons_true_focus
4:08.203 trickshots J aimed_shot Fluffy_Pillow 85.2/100: 85% focus blood_fury, lock_and_load, precise_shots, steady_focus, trick_shots, trueshot, wild_spirits, eagletalons_true_focus
4:09.394 trickshots L multishot Fluffy_Pillow 96.5/100: 96% focus blood_fury, precise_shots(2), steady_focus, trueshot, wild_spirits, eagletalons_true_focus
4:10.584 trickshots J aimed_shot Fluffy_Pillow 97.8/100: 98% focus blood_fury, precise_shots, steady_focus, trick_shots, trueshot, wild_spirits, eagletalons_true_focus
4:11.773 trickshots L multishot Fluffy_Pillow 83.9/100: 84% focus blood_fury, precise_shots(2), steady_focus, trueshot, wild_spirits, eagletalons_true_focus
4:12.962 trickshots J aimed_shot Fluffy_Pillow 85.2/100: 85% focus blood_fury, precise_shots, steady_focus, trick_shots, trueshot, wild_spirits, eagletalons_true_focus
4:14.150 trickshots L multishot Fluffy_Pillow 78.5/100: 78% focus blood_fury, precise_shots(2), steady_focus, trueshot, wild_spirits, eagletalons_true_focus
4:15.339 trickshots J aimed_shot Fluffy_Pillow 79.8/100: 80% focus blood_fury, precise_shots, steady_focus, trick_shots, trueshot, wild_spirits, eagletalons_true_focus
4:16.528 trickshots L multishot Fluffy_Pillow 72.8/100: 73% focus blood_fury, precise_shots(2), trueshot, wild_spirits, eagletalons_true_focus
4:17.799 trickshots J aimed_shot Fluffy_Pillow 74.1/100: 74% focus blood_fury, precise_shots, trick_shots, trueshot, wild_spirits, eagletalons_true_focus
4:19.070 trickshots L multishot Fluffy_Pillow 67.3/100: 67% focus precise_shots(2), trueshot, wild_spirits, eagletalons_true_focus
4:20.340 trickshots K rapid_fire Fluffy_Pillow 68.6/100: 69% focus precise_shots, trick_shots, trueshot, wild_spirits, eagletalons_true_focus
4:22.299 trickshots L multishot Fluffy_Pillow 96.0/100: 96% focus precise_shots, trueshot, eagletalons_true_focus
4:23.570 trickshots J aimed_shot Fluffy_Pillow 95.9/100: 96% focus trick_shots
4:25.689 trickshots L multishot Fluffy_Pillow 65.0/100: 65% focus precise_shots
4:26.961 trickshots J aimed_shot Fluffy_Pillow 52.6/100: 53% focus trick_shots
4:29.079 trickshots L multishot Fluffy_Pillow 30.1/100: 30% focus precise_shots
4:30.351 trickshots O steady_shot Fluffy_Pillow 17.6/100: 18% focus trick_shots
4:31.835 default 9 use_items Fluffy_Pillow 36.4/100: 36% focus trick_shots
4:31.835 trickshots F steady_shot Fluffy_Pillow 36.4/100: 36% focus trick_shots
4:33.319 trickshots N multishot Fluffy_Pillow 55.2/100: 55% focus steady_focus, trick_shots
4:34.507 trickshots K rapid_fire Fluffy_Pillow 42.7/100: 43% focus steady_focus, trick_shots
4:36.277 trickshots L multishot Fluffy_Pillow 60.9/100: 61% focus steady_focus
4:37.464 trickshots J aimed_shot Fluffy_Pillow 48.4/100: 48% focus steady_focus, trick_shots
4:39.442 trickshots L multishot Fluffy_Pillow 25.9/100: 26% focus precise_shots, steady_focus
4:40.631 trickshots O steady_shot Fluffy_Pillow 13.4/100: 13% focus steady_focus, trick_shots
4:42.017 trickshots M kill_shot Fluffy_Pillow 32.2/100: 32% focus steady_focus, trick_shots
4:43.206 trickshots O steady_shot Fluffy_Pillow 29.7/100: 30% focus steady_focus, trick_shots
4:44.593 trickshots F steady_shot Fluffy_Pillow 48.5/100: 49% focus steady_focus, trick_shots
4:45.979 trickshots J aimed_shot Fluffy_Pillow 67.3/100: 67% focus steady_focus, trick_shots
4:47.956 trickshots L multishot Fluffy_Pillow 44.8/100: 45% focus precise_shots(2), steady_focus
4:49.144 trickshots O steady_shot Fluffy_Pillow 32.3/100: 32% focus precise_shots, steady_focus, trick_shots
4:50.529 trickshots O steady_shot Fluffy_Pillow 51.1/100: 51% focus precise_shots, steady_focus, trick_shots
4:51.915 trickshots L multishot Fluffy_Pillow 69.9/100: 70% focus precise_shots, steady_focus, trick_shots
4:53.103 trickshots M kill_shot Fluffy_Pillow 57.4/100: 57% focus steady_focus, trick_shots
4:54.291 trickshots K rapid_fire Fluffy_Pillow 54.9/100: 55% focus steady_focus, trick_shots
4:56.274 trickshots G double_tap Fluffy_Pillow 74.5/100: 74% focus steady_focus
4:57.462 trickshots L multishot Fluffy_Pillow 82.0/100: 82% focus double_tap, steady_focus
4:58.650 trickshots J aimed_shot Fluffy_Pillow 69.5/100: 69% focus double_tap, steady_focus, trick_shots
5:00.629 trickshots L multishot Fluffy_Pillow 47.0/100: 47% focus precise_shots(2), steady_focus
5:01.818 trickshots O steady_shot Fluffy_Pillow 34.5/100: 35% focus precise_shots, steady_focus, trick_shots
5:03.203 trickshots F steady_shot Fluffy_Pillow 53.3/100: 53% focus precise_shots, steady_focus, trick_shots
5:04.588 trickshots L multishot Fluffy_Pillow 72.1/100: 72% focus precise_shots, steady_focus, trick_shots
5:05.775 trickshots J aimed_shot Fluffy_Pillow 59.6/100: 60% focus steady_focus, trick_shots
5:07.753 trickshots L multishot Fluffy_Pillow 37.1/100: 37% focus precise_shots(2), steady_focus
5:08.942 trickshots M kill_shot Fluffy_Pillow 24.6/100: 25% focus precise_shots, steady_focus, trick_shots
5:10.131 trickshots O steady_shot Fluffy_Pillow 22.2/100: 22% focus precise_shots, steady_focus, trick_shots
5:11.516 trickshots O steady_shot Fluffy_Pillow 40.9/100: 41% focus precise_shots, steady_focus, trick_shots
5:12.903 trickshots L multishot Fluffy_Pillow 59.7/100: 60% focus precise_shots, steady_focus, trick_shots
5:14.092 trickshots J aimed_shot Fluffy_Pillow 47.2/100: 47% focus steady_focus, trick_shots
5:16.070 trickshots L multishot Fluffy_Pillow 24.8/100: 25% focus precise_shots(2), steady_focus
5:17.261 trickshots K rapid_fire Fluffy_Pillow 12.3/100: 12% focus precise_shots, steady_focus, trick_shots
5:19.086 trickshots L multishot Fluffy_Pillow 30.8/100: 31% focus precise_shots, steady_focus
5:20.273 trickshots M kill_shot Fluffy_Pillow 18.4/100: 18% focus steady_focus, trick_shots
5:21.462 trickshots O steady_shot Fluffy_Pillow 15.9/100: 16% focus steady_focus, trick_shots
5:22.850 trickshots O steady_shot Fluffy_Pillow 34.7/100: 35% focus steady_focus, trick_shots
5:24.237 trickshots J aimed_shot Fluffy_Pillow 53.4/100: 53% focus steady_focus, trick_shots
5:26.214 trickshots L multishot Fluffy_Pillow 31.0/100: 31% focus precise_shots(2), steady_focus
5:27.402 cds E potion Fluffy_Pillow 18.5/100: 18% focus precise_shots, steady_focus, trick_shots
5:27.402 trickshots O steady_shot Fluffy_Pillow 18.5/100: 18% focus precise_shots, steady_focus, trick_shots, potion_of_spectral_agility
5:28.789 trickshots O steady_shot Fluffy_Pillow 37.3/100: 37% focus precise_shots, steady_focus, trick_shots, potion_of_spectral_agility
5:30.176 trickshots L multishot Fluffy_Pillow 56.0/100: 56% focus lock_and_load, precise_shots, steady_focus, trick_shots, potion_of_spectral_agility
5:31.366 trickshots J aimed_shot Fluffy_Pillow 43.6/100: 44% focus lock_and_load, steady_focus, trick_shots, potion_of_spectral_agility
5:32.557 trickshots L multishot Fluffy_Pillow 51.1/100: 51% focus precise_shots(2), steady_focus, potion_of_spectral_agility
5:33.746 trickshots M kill_shot Fluffy_Pillow 38.6/100: 39% focus precise_shots, steady_focus, trick_shots, potion_of_spectral_agility
5:34.934 trickshots O steady_shot Fluffy_Pillow 36.1/100: 36% focus precise_shots, steady_focus, trick_shots, potion_of_spectral_agility
5:36.320 trickshots J aimed_shot Fluffy_Pillow 54.9/100: 55% focus lock_and_load, precise_shots, steady_focus, trick_shots, potion_of_spectral_agility
5:37.509 trickshots L multishot Fluffy_Pillow 62.4/100: 62% focus precise_shots(2), steady_focus, potion_of_spectral_agility
5:38.697 trickshots K rapid_fire Fluffy_Pillow 50.0/100: 50% focus precise_shots, steady_focus, trick_shots, potion_of_spectral_agility
5:40.474 trickshots L multishot Fluffy_Pillow 68.2/100: 68% focus precise_shots, steady_focus, potion_of_spectral_agility
5:41.664 trickshots J aimed_shot Fluffy_Pillow 55.7/100: 56% focus steady_focus, trick_shots, potion_of_spectral_agility
5:43.643 trickshots L multishot Fluffy_Pillow 33.3/100: 33% focus precise_shots(2), steady_focus, potion_of_spectral_agility
5:44.833 trickshots M kill_shot Fluffy_Pillow 20.8/100: 21% focus precise_shots, steady_focus, trick_shots, potion_of_spectral_agility
5:46.022 trickshots O steady_shot Fluffy_Pillow 18.0/100: 18% focus precise_shots, trick_shots, potion_of_spectral_agility
5:47.508 trickshots F steady_shot Fluffy_Pillow 36.8/100: 37% focus precise_shots, trick_shots, potion_of_spectral_agility
5:48.994 trickshots L multishot Fluffy_Pillow 55.6/100: 56% focus precise_shots, steady_focus, trick_shots, potion_of_spectral_agility
5:50.182 trickshots J aimed_shot Fluffy_Pillow 43.1/100: 43% focus steady_focus, trick_shots, potion_of_spectral_agility
5:52.160 trickshots L multishot Fluffy_Pillow 20.6/100: 21% focus lock_and_load, precise_shots, steady_focus, potion_of_spectral_agility

Stats

Level Bonus (60) Race Bonus (orc) Raid-Buffed Unbuffed Gear Amount
Strength 274 3 295 277 0
Agility 450 -3 1411 1297 789 (677)
Stamina 414 1 1800 1715 1300
Intellect 369 -1 405 368 0
Spirit 0 0 0 0 0
Health 36000 34300 0
Focus 100 100 0
Spell Power 405 368 0
Crit 22.66% 22.66% 443
Haste 18.30% 18.30% 604
Versatility 3.65% 3.65% 146
Attack Power 1482 1297 0
Mastery 14.00% 14.00% 504
Armor 818 818 818
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 217.00
Local Head Helm of Insatiable Appetite
ilevel: 213, stats: { 103 Armor, +126 Sta, +92 Haste, +40 Mastery, +72 AgiInt }
Local Neck Noble's Birthstone Pendant
ilevel: 213, stats: { +71 Sta, +47 Crit, +147 Mastery }
Local Shoulders Boneshatter Pauldrons
ilevel: 235, stats: { 107 Armor, +124 Sta, +44 unknown(24), +44 unknown(25), +66 AgiInt }
item effects: { equip: Eagletalon's True Focus }
Local Chest Master Huntsman's Bandolier
ilevel: 213, stats: { 137 Armor, +126 Sta, +45 Crit, +86 Mastery, +72 AgiInt }, enchant: { +20 StrAgi }
Local Waist Load-Bearing Belt
ilevel: 213, stats: { 77 Armor, +95 Sta, +69 Haste, +30 Vers, +54 AgiInt }
Local Legs Greaves of Enigmatic Energies
ilevel: 213, stats: { 120 Armor, +126 Sta, +91 Crit, +41 Mastery, +72 AgiInt }
Local Feet Stoneclas Stompers
ilevel: 213, stats: { 86 Armor, +95 Sta, +69 Crit, +30 Mastery, +54 AgiInt }, enchant: { +15 Agi }
Local Wrists Bangles of Errant Pride
ilevel: 213, stats: { 69 Armor, +71 Sta, +48 Crit, +24 Mastery, +40 AgiInt }
Local Hands Oathsworn Soldier's Gauntlets
ilevel: 220, stats: { 80 Armor, +104 Sta, +67 Crit, +36 Haste, +58 AgiInt }
Local Finger1 Most Regal Signet of Sire Denathrius
ilevel: 220, stats: { +77 Sta, +161 Haste, +44 Mastery }, enchant: { +16 Crit }
item effects: { equip: Denathrius' Privilege }
Local Finger2 Ritualist's Treasured Ring
ilevel: 213, stats: { +71 Sta, +44 Crit, +149 Haste }, enchant: { +16 Crit }
Local Trinket1 Dreadfire Vessel
ilevel: 220, stats: { +73 StrAgiInt }, enchant: shadowcore_oil
item effects: { use: Dreadfire Vessel }
Local Trinket2 Stone Legion Heraldry
ilevel: 220, stats: { +73 StrAgi }
item effects: { equip: Stone Legionnaire }
Local Back Crest of the Legionnaire General
ilevel: 220, stats: { 39 Armor, +77 Sta, +52 Haste, +24 Vers, +43 StrAgiInt }
Local Main Hand Deadeye Blunderbuss
ilevel: 220, weapon: { 121 - 227, 3 }, stats: { +77 Agi, +137 Sta, +45 Haste, +92 Mastery }, enchant: sinful_revelation

Profile

hunter="eagle_true_focus"
source=default
spec=marksmanship
level=60
race=orc
role=attack
position=ranged_back
talents=1101032
covenant=night_fae
soulbind=140:6//188:6

# Default consumables
potion=spectral_agility
flask=spectral_flask_of_power
food=feast_of_gluttonous_hedonism
augmentation=veiled

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask
actions.precombat+=/augmentation
actions.precombat+=/food
# Snapshot raid buffed stats before combat begins and pre-potting is done.
actions.precombat+=/snapshot_stats
actions.precombat+=/tar_trap,if=runeforge.soulforge_embers
actions.precombat+=/double_tap,precast_time=10,if=!covenant.kyrian&(!talent.volley|active_enemies<2)
actions.precombat+=/aimed_shot,if=active_enemies<3
actions.precombat+=/steady_shot,if=active_enemies>2

# Executed every time the actor is available.
actions=auto_shot
actions+=/counter_shot,line_cd=30,if=runeforge.sephuzs_proclamation|soulbind.niyas_tools_poison|(conduit.reversal_of_fortune&!runeforge.sephuzs_proclamation)
actions+=/use_items
actions+=/call_action_list,name=cds
actions+=/call_action_list,name=st,if=active_enemies<3
actions+=/call_action_list,name=trickshots,if=active_enemies>2

actions.cds=berserking,if=buff.trueshot.up|target.time_to_die<13
actions.cds+=/blood_fury,if=buff.trueshot.up|target.time_to_die<16
actions.cds+=/ancestral_call,if=buff.trueshot.up|target.time_to_die<16
actions.cds+=/fireblood,if=buff.trueshot.up|target.time_to_die<9
actions.cds+=/lights_judgment,if=buff.trueshot.down
actions.cds+=/bag_of_tricks,if=buff.trueshot.down
actions.cds+=/potion,if=buff.trueshot.up&buff.bloodlust.up|buff.trueshot.up&target.health.pct<20|target.time_to_die<26

actions.st=steady_shot,if=talent.steady_focus&(prev_gcd.1.steady_shot&buff.steady_focus.remains<5|buff.steady_focus.down)
actions.st+=/kill_shot
actions.st+=/double_tap,if=covenant.kyrian&cooldown.resonating_arrow.remains<gcd|!covenant.kyrian&(cooldown.aimed_shot.up|cooldown.rapid_fire.remains>cooldown.aimed_shot.remains)
actions.st+=/flare,if=tar_trap.up&runeforge.soulforge_embers
actions.st+=/tar_trap,if=runeforge.soulforge_embers&tar_trap.remains<gcd&cooldown.flare.remains<gcd
actions.st+=/explosive_shot
actions.st+=/wild_spirits
actions.st+=/flayed_shot
actions.st+=/death_chakram,if=focus+cast_regen<focus.max
actions.st+=/volley,if=buff.precise_shots.down|!talent.chimaera_shot|active_enemies<2
actions.st+=/a_murder_of_crows
actions.st+=/resonating_arrow
actions.st+=/trueshot,if=buff.precise_shots.down|buff.resonating_arrow.up|buff.wild_spirits.up|buff.volley.up&active_enemies>1
actions.st+=/aimed_shot,target_if=min:(dot.serpent_sting.remains<?action.serpent_sting.in_flight_to_target*dot.serpent_sting.duration),if=buff.precise_shots.down|(buff.trueshot.up|full_recharge_time<gcd+cast_time)&(!talent.chimaera_shot|active_enemies<2)|buff.trick_shots.remains>execute_time&active_enemies>1
actions.st+=/rapid_fire,if=focus+cast_regen<focus.max&(buff.trueshot.down|!runeforge.eagletalons_true_focus)&(buff.double_tap.down|talent.streamline)
actions.st+=/chimaera_shot,if=buff.precise_shots.up|focus>cost+action.aimed_shot.cost
actions.st+=/arcane_shot,if=buff.precise_shots.up|focus>cost+action.aimed_shot.cost
actions.st+=/serpent_sting,target_if=min:remains,if=refreshable&target.time_to_die>duration
actions.st+=/barrage,if=active_enemies>1
actions.st+=/rapid_fire,if=focus+cast_regen<focus.max&(buff.double_tap.down|talent.streamline)
actions.st+=/steady_shot

actions.trickshots=steady_shot,if=talent.steady_focus&in_flight&buff.steady_focus.remains<5
actions.trickshots+=/double_tap,if=covenant.kyrian&cooldown.resonating_arrow.remains<gcd|cooldown.rapid_fire.remains<cooldown.aimed_shot.full_recharge_time|!(talent.streamline&runeforge.surging_shots)|!covenant.kyrian
actions.trickshots+=/tar_trap,if=runeforge.soulforge_embers&tar_trap.remains<gcd&cooldown.flare.remains<gcd
actions.trickshots+=/flare,if=tar_trap.up&runeforge.soulforge_embers
actions.trickshots+=/explosive_shot
actions.trickshots+=/wild_spirits
actions.trickshots+=/resonating_arrow
actions.trickshots+=/volley
actions.trickshots+=/barrage
actions.trickshots+=/trueshot
actions.trickshots+=/rapid_fire,if=buff.trick_shots.remains>=execute_time&runeforge.surging_shots&buff.double_tap.down
actions.trickshots+=/aimed_shot,target_if=min:(dot.serpent_sting.remains<?action.serpent_sting.in_flight_to_target*dot.serpent_sting.duration),if=buff.trick_shots.remains>=execute_time&(buff.precise_shots.down|full_recharge_time<cast_time+gcd|buff.trueshot.up)
actions.trickshots+=/death_chakram,if=focus+cast_regen<focus.max
actions.trickshots+=/rapid_fire,if=buff.trick_shots.remains>=execute_time
actions.trickshots+=/multishot,if=buff.trick_shots.down|buff.precise_shots.up&focus>cost+action.aimed_shot.cost&(!talent.chimaera_shot|active_enemies>3)
actions.trickshots+=/chimaera_shot,if=buff.precise_shots.up&focus>cost+action.aimed_shot.cost&active_enemies<4
actions.trickshots+=/kill_shot,if=buff.dead_eye.down
actions.trickshots+=/a_murder_of_crows
actions.trickshots+=/flayed_shot
actions.trickshots+=/serpent_sting,target_if=min:dot.serpent_sting.remains,if=refreshable
actions.trickshots+=/multishot,if=focus>cost+action.aimed_shot.cost
actions.trickshots+=/steady_shot

head=helm_of_insatiable_appetite,id=183001,bonus_id=7188/1485,ilevel=213
neck=nobles_birthstone_pendant,id=183039,bonus_id=7188/1485,ilevel=213
shoulders=boneshatter_pauldrons,id=172327,bonus_id=7011,ilevel=235
back=crest_of_the_legionnaire_general,id=183032,bonus_id=6805,ilevel=220
chest=master_huntsmans_bandolier,id=182988,bonus_id=6805,ilevel=213,enchant=eternal_skirmish
wrists=bangles_of_errant_pride,id=182977,bonus_id=6805,ilevel=213
hands=oathsworn_soldiers_gauntlets,id=182991,bonus_id=6805,ilevel=220
waist=loadbearing_belt,id=183016,bonus_id=6805,ilevel=213
legs=greaves_of_enigmatic_energies,id=183012,bonus_id=6805,ilevel=213
feet=stoneclas_stompers,id=183006,bonus_id=6805,ilevel=213,enchant=15agility
finger1=most_regal_signet_of_sire_denathrius,id=183036,bonus_id=6805,ilevel=220,enchant=16crit
finger2=ritualists_treasured_ring,id=183037,bonus_id=6805,ilevel=213,enchant=16crit
trinket1=dreadfire_vessel,id=184030,bonus_id=6805,ilevel=220,enchant=shadowcore_oil
trinket2=stone_legion_heraldry,id=184027,bonus_id=6805,ilevel=220
main_hand=deadeye_blunderbuss,id=184250,bonus_id=6805,ilevel=220,enchant=sinful_revelation

# Gear Summary
# gear_ilvl=217.27
# gear_agility=789
# gear_stamina=1300
# gear_crit_rating=443
# gear_haste_rating=604
# gear_mastery_rating=504
# gear_versatility_rating=54
# gear_armor=818

marksmanship : 9932 dps, 3082 dps to main target

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
9932.2 9932.2 16.8 / 0.169% 1169.3 / 11.8% 989.3
RPS Out RPS In Primary Resource Waiting APM Active Skill
10.0 9.8 Focus 0.00% 47.1 100.0% 100%
Talents
Runeforge

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
marksmanship 9932
Aimed Shot 3520 (3919) 35.4% (39.4%) 46.3 6.50sec 25323 15967 Direct 231.3 (256.9) 3716 7428 4557 22.7% (22.6%)

Stats Details: Aimed Shot

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 46.33 231.33 0.00 0.00 1.5859 0.0000 1054293.54 1505952.89 29.99% 15967.50 15967.50
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 77.34% 178.90 123 237 3716.15 2524 9493 3717.85 3511 3971 664841 949658 29.99%
crit 22.66% 52.43 28 80 7427.70 5048 18985 7433.73 6286 9112 389453 556295 29.99%

Action Details: Aimed Shot

  • id:19434
  • school:physical
  • range:40.0
  • travel_speed:100.0000
  • radius:8.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:12.000
  • cooldown hasted:true
  • base_recharge_multiplier:1.000
  • base_execute_time:2.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:focus
  • base_cost:35.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:19434
  • name:Aimed Shot
  • school:physical
  • tooltip:
  • description:A powerful aimed shot that deals {$s1=0} Physical damage.

Action Priority List

    trickshots
    [I]:46.55
  • if_expr:buff.trick_shots.remains>=execute_time&(buff.precise_shots.down|full_recharge_time<cast_time+gcd|buff.trueshot.up)
  • target_if_expr:(dot.serpent_sting.remains<?action.serpent_sting.in_flight_to_target*dot.serpent_sting.duration)
    Aimed Shot (_double_tap) 399 4.0% 0.0 0.00sec 0 0 Direct 25.6 3798 7611 4653 22.4%

Stats Details: Aimed Shot Double Tap

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 0.00 25.58 0.00 0.00 0.0000 0.0000 118982.33 169954.36 29.99% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 77.61% 19.85 6 32 3798.47 2524 9493 3814.22 3048 5139 75377 107668 29.99%
crit 22.39% 5.73 0 12 7611.36 5048 18985 7585.83 0 18985 43605 62286 29.84%

Action Details: Aimed Shot Double Tap

  • id:19434
  • school:physical
  • range:40.0
  • travel_speed:100.0000
  • radius:8.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:12.000
  • cooldown hasted:true
  • base_recharge_multiplier:1.000
  • base_execute_time:2.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:focus
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:19434
  • name:Aimed Shot
  • school:physical
  • tooltip:
  • description:A powerful aimed shot that deals {$s1=0} Physical damage.
Auto Shot 373 3.8% 113.4 2.65sec 985 435 Direct 113.2 805 1610 988 22.7%

Stats Details: Auto Shot

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 113.43 113.19 0.00 0.00 2.2667 0.0000 111785.41 159674.28 29.99% 434.77 434.77
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 77.31% 87.51 59 115 804.93 774 970 804.85 791 821 70440 100616 29.99%
crit 22.69% 25.68 11 42 1609.78 1548 1940 1609.50 1554 1679 41345 59058 29.99%

Action Details: Auto Shot

  • id:75
  • school:physical
  • range:40.0
  • travel_speed:60.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00

Spelldata

  • id:75
  • name:Auto Shot
  • school:physical
  • tooltip:Firing at the target.
  • description:Automatically shoots the target until cancelled.
Dreadfire Vessel 138 1.4% 3.7 90.71sec 11091 0 Direct 3.7 9043 18080 11118 23.0%

Stats Details: Dreadfire Vessel

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 3.73 3.72 0.00 0.00 0.0000 0.0000 41391.78 41391.78 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 77.05% 2.87 0 4 9043.36 8937 9474 9005.18 0 9474 25941 25941 0.00%
crit 22.95% 0.85 0 3 18080.00 17875 18947 11307.44 0 18947 15451 15451 0.00%

Action Details: Dreadfire Vessel

  • id:344732
  • school:fire
  • range:50.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:90.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:8212.26
  • base_dd_max:8212.26
  • base_dd_mult:1.00

Spelldata

  • id:344732
  • name:Dreadfire Vessel
  • school:fire
  • tooltip:
  • description:Unleash incendiary flames at your target inflicting {$s1=0} Fire damage.
Eternal Skirmish 39 0.4% 21.9 13.47sec 541 0 Direct 21.9 442 884 541 22.3%

Stats Details: Eternal Skirmish

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 21.86 21.86 0.00 0.00 0.0000 0.0000 11816.85 11816.85 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 77.70% 16.99 5 33 442.05 435 461 442.03 435 454 7508 7508 0.00%
crit 22.30% 4.87 0 14 884.20 871 923 880.51 0 923 4309 4309 0.00%

Action Details: Eternal Skirmish

  • id:323889
  • school:shadow
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:400.00
  • base_dd_max:400.00
  • base_dd_mult:1.00

Spelldata

  • id:323889
  • name:Eternal Skirmish
  • school:shadow
  • tooltip:
  • description:Deals {$s1=400} Shadow damage.
Kill Shot 85 0.9% 4.7 13.17sec 5405 4530 Direct 4.7 4227 9514 5455 23.2%

Stats Details: Kill Shot

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 4.70 4.66 0.00 0.00 1.1933 0.0000 25418.32 36307.52 29.99% 4530.09 4530.09
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 76.75% 3.58 0 6 4226.88 4065 4796 4213.50 0 4796 15113 21587 29.94%
crit 23.25% 1.08 0 6 9514.07 9146 10792 6715.23 0 10792 10305 14720 21.17%

Action Details: Kill Shot

  • id:53351
  • school:physical
  • range:40.0
  • travel_speed:80.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:10.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:focus
  • base_cost:10.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:53351
  • name:Kill Shot
  • school:physical
  • tooltip:
  • description:You attempt to finish off a wounded target, dealing {$s1=0} Physical damage. Only usable on enemies with less than {$s2=20}% health.

Action Priority List

    trickshots
    [L]:4.70
  • if_expr:buff.dead_eye.down
Master Marksman 470 4.7% 308.3 0.99sec 457 0 Periodic 527.0 267 0 267 0.0% 70.3%

Stats Details: Master Marksman

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 308.31 0.00 526.99 526.99 0.0000 2.0000 140902.01 140902.01 0.00% 133.69 0.00
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 100.00% 526.99 394 681 267.34 37 1981 267.40 206 322 140902 140902 0.00%

Action Details: Master Marksman

  • id:269576
  • school:physical
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:false
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:6.00
  • base_tick_time:2.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH

Spelldata

  • id:269576
  • name:Master Marksman
  • school:physical
  • tooltip:Bleeding for $w1 damage every $t1 sec.
  • description:{$@spelldesc260309=Your ranged special attack critical strikes cause the target to bleed for an additional {$s1=15}% of the damage dealt over {$269576d=6 seconds}.}
Multi-Shot 2659 26.8% 82.1 3.65sec 9712 8523 Direct 409.4 1586 3172 1947 22.7%

Stats Details: Multishot

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 82.06 409.40 0.00 0.00 1.1395 0.0000 796958.09 1138374.93 29.99% 8522.80 8522.80
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 77.29% 316.41 238 392 1586.26 953 2090 1586.08 1476 1689 501955 716992 29.99%
crit 22.71% 92.99 56 137 3172.07 1905 4180 3171.61 2846 3422 295004 421383 29.99%

Action Details: Multishot

  • id:257620
  • school:physical
  • range:40.0
  • travel_speed:50.0000
  • radius:10.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:5
  • harmful:true

Resources

  • resource:focus
  • base_cost:20.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:257620
  • name:Multi-Shot
  • school:physical
  • tooltip:
  • description:Fires several missiles, hitting your current target and up to $I enemies within $A1 yards for {$s1=0} Physical damage.

Action Priority List

    trickshots
    [K]:73.51
  • if_expr:buff.trick_shots.down|buff.precise_shots.up&focus>cost+action.aimed_shot.cost&(!talent.chimaera_shot|active_enemies>3)
    trickshots
    [M]:8.55
  • if_expr:focus>cost+action.aimed_shot.cost
Rapid Fire 1030 10.4% 16.1 18.87sec 19220 10996 Periodic 573.3 439 876 538 22.7% 1.6%

Stats Details: Rapid Fire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 16.06 0.00 115.00 573.28 1.7480 0.2088 308700.80 440948.22 29.99% 10995.58 10995.58
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 77.32% 443.28 308 617 439.33 351 881 439.34 426 454 194755 278188 29.99%
crit 22.68% 130.00 73 195 876.42 703 1762 876.34 794 959 113946 162760 29.99%

Action Details: Rapid Fire

  • id:257044
  • school:physical
  • range:40.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:20.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:false
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:2.00
  • base_tick_time:0.33
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH

Spelldata

  • id:257044
  • name:Rapid Fire
  • school:physical
  • tooltip:Being targeted by Rapid Fire.
  • description:Shoot a stream of {$s1=7} shots at your target over {$d=2 seconds}, dealing a total of ${$m1*$257045sw1} Physical damage. {$?s321281=true}[ Each shot generates {$263585s1=1} Focus.][] Usable while moving.

Action Details: Rapid Fire Damage

  • id:257045
  • school:physical
  • range:40.0
  • travel_speed:40.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:on_hit
  • energize_resource:focus
  • energize_amount:1.0

Spelldata

  • id:257045
  • name:Rapid Fire
  • school:physical
  • tooltip:
  • description:{$@spelldesc257044=Shoot a stream of {$s1=7} shots at your target over {$d=2 seconds}, dealing a total of ${$m1*$257045sw1} Physical damage. {$?s321281=true}[ Each shot generates {$263585s1=1} Focus.][] Usable while moving.}

Action Priority List

    trickshots
    [J]:16.06
  • if_expr:buff.trick_shots.remains>=execute_time
Serpent Sting 817 8.2% 0.0 0.00sec 0 0 Direct 46.2 499 997 610 22.3%
Periodic 374.1 472 944 579 22.7% 53.8%

Stats Details: Serpent Sting

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 0.00 46.21 374.12 374.12 0.0000 2.1552 244824.10 244824.10 0.00% 303.64 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 77.71% 35.91 20 50 498.86 479 600 498.87 487 509 17912 17912 0.00%
crit 22.29% 10.30 1 20 997.37 958 1201 997.71 958 1133 10274 10274 0.00%
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 77.33% 289.29 204 373 472.00 3 600 472.06 463 480 136553 136553 0.00%
crit 22.67% 84.83 47 123 944.09 50 1201 944.24 887 990 80085 80085 0.00%

Action Details: Serpent Sting

  • id:271788
  • school:nature
  • range:40.0
  • travel_speed:45.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:focus
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.165000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:18.00
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH

Spelldata

  • id:271788
  • name:Serpent Sting
  • school:nature
  • tooltip:Suffering {$s2=0} Nature damage every $t2 sec.
  • description:Fire a shot that poisons your target, causing them to take {$s1=0} Nature damage instantly and an additional $o2 Nature damage over {$d=18 seconds}.
Shadowcore Oil Blast 44 0.4% 44.0 6.70sec 297 0 Direct 44.0 242 484 297 22.9%

Stats Details: Shadowcore Oil Blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 44.01 44.01 0.00 0.00 0.0000 0.0000 13091.24 13091.24 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 77.10% 33.93 16 56 242.00 239 254 242.00 239 247 8211 8211 0.00%
crit 22.90% 10.08 2 24 484.09 479 508 484.07 479 500 4880 4880 0.00%

Action Details: Shadowcore Oil Blast

  • id:336463
  • school:shadow
  • range:60.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:220.00
  • base_dd_max:220.00
  • base_dd_mult:1.00

Spelldata

  • id:336463
  • name:Shadowcore Oil Blast
  • school:shadow
  • tooltip:
  • description:Deals {$s1=220} Shadow damage.
Steady Shot 359 3.6% 69.0 4.32sec 1561 1159 Direct 69.9 1257 2512 1541 22.6%

Stats Details: Steady Shot

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 69.03 69.93 0.00 0.00 1.3471 0.0000 107761.14 153926.02 29.99% 1158.91 1158.91
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 77.40% 54.12 36 73 1257.40 1219 1529 1257.15 1230 1281 68057 97213 29.99%
crit 22.60% 15.80 4 31 2512.22 2439 3057 2511.39 2439 2694 39704 56713 29.99%

Action Details: Steady Shot

  • id:56641
  • school:physical
  • range:40.0
  • travel_speed:75.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:1.75
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:on_cast
  • energize_resource:focus
  • energize_amount:10.0

Spelldata

  • id:56641
  • name:Steady Shot
  • school:physical
  • tooltip:
  • description:A steady shot that causes {$s1=0} Physical damage. Usable while moving.{$?s321018=true}[ |cFFFFFFFFGenerates {$s2=0} Focus.][]

Action Priority List

    trickshots
    [F]:15.61
  • if_expr:talent.steady_focus&in_flight&buff.steady_focus.remains<5
    trickshots
    [N]:53.67
Simple Action Stats Execute Interval
marksmanship
Veiled Augmentation (augmentation) 1.0 0.00sec

Stats Details: Augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Augmentation

  • id:347901
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:marksmanship
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Blood Fury 3.0 120.64sec

Stats Details: Blood Fury

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.98 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Blood Fury

  • id:20572
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:120.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:20572
  • name:Blood Fury
  • school:physical
  • tooltip:Attack power increased by $w1.
  • description:Increases your attack power by {$s1=122} for {$d=15 seconds}.

Action Priority List

    cds
    [D]:2.98
  • if_expr:buff.trueshot.up|target.time_to_die<16
Double Tap 5.6 60.60sec

Stats Details: Double Tap

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 5.59 0.00 0.00 0.00 0.9767 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Double Tap

  • id:260402
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:60.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:260402
  • name:Double Tap
  • school:physical
  • tooltip:Your next Aimed Shot will fire a second time instantly at {$s4=100}% power and consume no Focus, or your next Rapid Fire will shoot {$s3=100}% additional shots during its channel.
  • description:Your next Aimed Shot will fire a second time instantly at {$s4=100}% power without consuming Focus, or your next Rapid Fire will shoot {$s3=100}% additional shots during its channel.

Action Priority List

    trickshots
    [G]:4.60
  • if_expr:covenant.kyrian&cooldown.resonating_arrow.remains<gcd|cooldown.rapid_fire.remains<cooldown.aimed_shot.full_recharge_time|!(talent.streamline&runeforge.surging_shots)|!covenant.kyrian
Spectral Flask of Power (flask) 1.0 0.00sec

Stats Details: Flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Flask

  • id:307185
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:marksmanship
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Feast of Gluttonous Hedonism (food) 1.0 0.00sec

Stats Details: Food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Food

  • id:308462
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:marksmanship
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Potion of Spectral Agility (potion) 1.5 310.27sec

Stats Details: Potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.48 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Potion

  • id:307159
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:300.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Action Priority List

    cds
    [E]:1.48
  • if_expr:buff.trueshot.up&buff.bloodlust.up|buff.trueshot.up&target.health.pct<20|target.time_to_die<26
Trueshot 3.0 120.64sec

Stats Details: Trueshot

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.98 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Trueshot

  • id:288613
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:attack_haste
  • min_gcd:0.0000
  • cooldown:120.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:288613
  • name:Trueshot
  • school:physical
  • tooltip:The cooldown of Aimed Shot and Rapid Fire is reduced by ${$m1/4}%, and Aimed Shot casts {$s4=50}% faster. All Focus generation is increased by {$s5=50}%.
  • description:Reduces the cooldown of your Aimed Shot and Rapid Fire by ${$m1/4}%, and causes Aimed Shot to cast {$s4=50}% faster for {$d=15 seconds}. While Trueshot is active, you generate {$s5=50}% additional Focus.

Action Priority List

    trickshots
    [H]:2.98

Buffs

Dynamic Buffs Start Refresh Interval Trigger Avg Dur Up-Time Benefit Overflow Expiry
Blood Fury 3.0 0.0 120.6sec 120.6sec 14.7sec 14.69% 0.00% 0.0 (0.0) 2.8

Buff Details

  • buff initial source:marksmanship
  • cooldown name:buff_blood_fury
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:120.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:attack_power
  • amount:122.00

Trigger Details

  • interval_min/max:120.0s / 122.7s
  • trigger_min/max:120.0s / 122.7s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 15.0s

Stack Uptimes

  • blood_fury_1:14.69%

Spelldata

  • id:20572
  • name:Blood Fury
  • tooltip:Attack power increased by $w1.
  • description:Increases your attack power by {$s1=122} for {$d=15 seconds}.
  • max_stacks:0
  • duration:15.00
  • cooldown:120.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 40.0sec 13.52% 0.00% 0.0 (0.0) 1.0

Buff Details

  • buff initial source:marksmanship
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • base duration:40.00
  • duration modifier:1.00
  • base cooldown:300.00
  • default_chance:100.00%
  • default_value:0.30
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:40.0s / 40.0s

Stack Uptimes

  • bloodlust_1:13.52%

Spelldata

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by $w1%.
  • description:Increases haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Double Tap 5.6 0.0 58.4sec 60.6sec 4.6sec 8.60% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:marksmanship
  • cooldown name:buff_double_tap
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.50
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:50.0s / 62.7s
  • trigger_min/max:60.0s / 62.7s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 11.3s

Stack Uptimes

  • double_tap_1:8.60%

Spelldata

  • id:260402
  • name:Double Tap
  • tooltip:Your next Aimed Shot will fire a second time instantly at {$s4=100}% power and consume no Focus, or your next Rapid Fire will shoot {$s3=100}% additional shots during its channel.
  • description:Your next Aimed Shot will fire a second time instantly at {$s4=100}% power without consuming Focus, or your next Rapid Fire will shoot {$s3=100}% additional shots during its channel.
  • max_stacks:0
  • duration:15.00
  • cooldown:60.00
  • default_chance:0.00%
Well Fed (feast_of_gluttonous_hedonism) 1.0 0.0 0.0sec 0.0sec 300.0sec 100.00% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:marksmanship
  • cooldown name:buff_feast_of_gluttonous_hedonism
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:agility
  • amount:20.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:240.1s / 359.8s

Stack Uptimes

  • feast_of_gluttonous_hedonism_1:100.00%

Spelldata

  • id:327709
  • name:Well Fed
  • tooltip:Agility increased by $w1.
  • description:Agility increased by {$s1=20}. Lasts {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Lock and Load 8.7 0.2 31.3sec 30.5sec 1.9sec 5.41% 18.31% 0.2 (0.2) 0.0

Buff Details

  • buff initial source:marksmanship
  • cooldown name:buff_lock_and_load
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:8.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:1.8s / 250.1s
  • trigger_min/max:1.8s / 250.1s
  • trigger_pct:7.83%
  • duration_min/max:0.0s / 10.1s

Stack Uptimes

  • lock_and_load_1:5.41%

Spelldata

  • id:194594
  • name:Lock and Load
  • tooltip:Aimed Shot costs no Focus and is instant.
  • description:{$@spelldesc194595=Your ranged auto attacks have a {$194595h=8}% chance to trigger Lock and Load, causing your next Aimed Shot to cost no Focus and be instant.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%

Trigger Spelldata

  • id:194595
  • name:Lock and Load
  • tooltip:
  • description:Your ranged auto attacks have a {$194595h=8}% chance to trigger Lock and Load, causing your next Aimed Shot to cost no Focus and be instant.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:8.00%
Potion of Spectral Agility 1.5 0.0 309.7sec 309.7sec 23.4sec 11.31% 0.00% 0.0 (0.0) 1.2

Buff Details

  • buff initial source:marksmanship
  • cooldown name:buff_potion_of_spectral_agility
  • max_stacks:1
  • base duration:25.00
  • duration modifier:1.00
  • base cooldown:1.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:agility
  • amount:190.00

Trigger Details

  • interval_min/max:300.0s / 334.1s
  • trigger_min/max:300.0s / 334.1s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 25.0s

Stack Uptimes

  • potion_of_spectral_agility_1:11.31%

Spelldata

  • id:307159
  • name:Potion of Spectral Agility
  • tooltip:Agility increased by $w1.
  • description:Increases your Agility by {$s1=190} for {$d=25 seconds}.
  • max_stacks:0
  • duration:25.00
  • cooldown:1.00
  • default_chance:0.00%
Precise Shots 40.7 5.7 7.4sec 6.5sec 2.7sec 36.65% 80.64% 2.7 (2.7) 0.0

Buff Details

  • buff initial source:marksmanship
  • cooldown name:buff_precise_shots
  • max_stacks:2
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.50
  • default_chance:101.00%
  • default_value:0.75
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.9s / 32.1s
  • trigger_min/max:0.9s / 14.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 28.7s

Stack Uptimes

  • precise_shots_1:31.80%
  • precise_shots_2:4.85%

Spelldata

  • id:260242
  • name:Precise Shots
  • tooltip:Damage of {$?s342049=false}[Chimaera Shot][Arcane Shot] or Multi-Shot increased by {$s1=75}%.
  • description:{$@spelldesc260240=Aimed Shot causes your next 1-{$260242u=2} {$?s342049=false}[Chimaera Shots][Arcane Shots] or Multi-Shots to deal {$260242s1=75}% more damage.}
  • max_stacks:2
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
Spectral Flask of Power 1.0 0.0 0.0sec 0.0sec 300.0sec 100.00% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:marksmanship
  • cooldown name:buff_spectral_flask_of_power
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:agility
  • amount:70.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:240.1s / 359.8s

Stack Uptimes

  • spectral_flask_of_power_1:100.00%

Spelldata

  • id:307185
  • name:Spectral Flask of Power
  • tooltip:$pri increased by $w1.
  • description:Increases $pri by {$s1=70} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Steady Focus 5.8 19.5 55.8sec 12.0sec 49.6sec 95.15% 0.00% 19.5 (19.5) 4.8

Buff Details

  • buff initial source:marksmanship
  • cooldown name:buff_steady_focus
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.07
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:15.0s / 327.7s
  • trigger_min/max:3.0s / 34.3s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 326.5s

Stack Uptimes

  • steady_focus_1:95.15%

Spelldata

  • id:193534
  • name:Steady Focus
  • tooltip:Haste increased by {$s1=7}%.
  • description:{$@spelldesc193533=Using Steady Shot twice in a row increases your Haste by {$193534s1=7}% for {$193534d=15 seconds}.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%

Trigger Spelldata

  • id:193533
  • name:Steady Focus
  • tooltip:
  • description:Using Steady Shot twice in a row increases your Haste by {$193534s1=7}% for {$193534d=15 seconds}.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
Trick Shots 63.2 18.9 4.7sec 3.7sec 4.3sec 89.91% 100.00% 18.9 (18.9) 0.0

Buff Details

  • buff initial source:marksmanship
  • cooldown name:buff_trick_shots
  • max_stacks:1
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:1.8s / 12.3s
  • trigger_min/max:0.9s / 11.1s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 12.3s

Stack Uptimes

  • trick_shots_1:89.91%

Spelldata

  • id:257622
  • name:Trick Shots
  • tooltip:Your next Aimed Shot or Rapid Fire will ricochet and hit {$257621s1=5} additional targets for {$257621s4=50}% of normal damage.
  • description:{$@spelldesc257621=When Multi-Shot hits {$s2=3} or more targets, your next Aimed Shot or Rapid Fire will ricochet and hit up to {$s1=5} additional targets for {$s4=50}% of normal damage.}
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
Trueshot 3.0 0.0 120.6sec 120.6sec 14.7sec 14.68% 0.00% 0.0 (0.0) 2.8

Buff Details

  • buff initial source:marksmanship
  • cooldown name:buff_trueshot
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.50
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:120.0s / 122.7s
  • trigger_min/max:120.0s / 122.7s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 15.0s

Stack Uptimes

  • trueshot_1:14.68%

Spelldata

  • id:288613
  • name:Trueshot
  • tooltip:The cooldown of Aimed Shot and Rapid Fire is reduced by ${$m1/4}%, and Aimed Shot casts {$s4=50}% faster. All Focus generation is increased by {$s5=50}%.
  • description:Reduces the cooldown of your Aimed Shot and Rapid Fire by ${$m1/4}%, and causes Aimed Shot to cast {$s4=50}% faster for {$d=15 seconds}. While Trueshot is active, you generate {$s5=50}% additional Focus.
  • max_stacks:0
  • duration:15.00
  • cooldown:120.00
  • default_chance:0.00%
Veiled Augmentation 1.0 0.0 0.0sec 0.0sec 300.0sec 100.00% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:marksmanship
  • cooldown name:buff_veiled_augmentation
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:agility
  • amount:18.00
  • stat:strength
  • amount:18.00
  • stat:intellect
  • amount:18.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:240.1s / 359.8s

Stack Uptimes

  • veiled_augmentation_1:100.00%

Spelldata

  • id:347901
  • name:Veiled Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=18} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Windfury Totem 1.0 0.0 0.0sec 0.0sec 300.0sec 100.00% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:marksmanship
  • cooldown name:buff_windfury_totem
  • max_stacks:1
  • base duration:900.00
  • duration modifier:1.00
  • base cooldown:0.50
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:240.1s / 359.8s

Stack Uptimes

  • windfury_totem_1:100.00%

Spelldata

  • id:327942
  • name:Windfury Totem
  • tooltip:Your auto-attacks have a {$h=10}% chance to instantly attack again.
  • description:{$@spelldesc8512=Summons a Windfury Totem with {$s1=5} health at the feet of the caster for {$d=120 seconds}. Party members within {$s2=30} yds have a {$327942h=10}% chance when they auto-attack to swing an extra time.}
  • max_stacks:0
  • duration:120.00
  • cooldown:0.00
  • default_chance:10.00%
Constant Buffs
Arcane Intellect

Buff Details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff Details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:15.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
Power Word: Fortitude

Buff Details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.$?$w2>0[ Magic damage taken reduced by $w2%.][]
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Procs, Uptimes & Benefits

Proc Count Min Max Interval Min Max
double_tap_aimed 5.1 2.0 7.0 62.2s 48.0s 190.5s
double_tap_rapid_fire 0.4 0.0 3.0 79.9s 54.8s 185.2s
Uptime Avg % Min Max Avg Dur Min Max
Focus Cap 0.52% 0.41% 1.38% 0.6s 0.0s 1.5s

Cooldown waste details

Seconds per ExecuteSeconds per Iteration
AbilityAverageMinimumMaximumAverageMinimumMaximum
Double Tap0.7510.0012.7112.8350.1717.798
Aimed Shot1.2100.0016.7449.4941.75719.296
Kill Shot3.5720.00118.61912.0440.18130.490
Trueshot0.7520.0012.7011.2560.0004.414
Rapid Fire2.7120.00120.59835.02512.09061.297

Resources

Gains Type Count Total Tot% Avg Overflow Ovr%
marksmanship
steady_shot Focus 70.02 680.18 23.10% 9.71 20.01 2.86%
rapid_fire Focus 114.99 114.92 3.90% 1.00 0.06 0.05%
focus_regen Focus 580.19 1954.36 66.37% 3.37 10.82 0.55%
Trueshot Focus 117.37 194.99 6.62% 1.66 1.07 0.55%
Change Start Gain/s Loss/s Overflow (Total) End (Avg) Min Max
Focus 100.0 9.82 10.03 32.0 36.5 0.1 100.0
Usage Type Count Total Avg RPE APR
marksmanship
aimed_shot Focus 46.3 1319.7 28.5 28.5 889.0
kill_shot Focus 4.7 47.0 10.0 10.0 540.4
multishot Focus 82.1 1641.2 20.0 20.0 485.6

Statistics & Data Analysis

Fight Length
marksmanship Fight Length
Count 1217
Mean 299.97
Minimum 240.10
Maximum 359.83
Spread ( max - min ) 119.74
Range [ ( max - min ) / 2 * 100% ] 19.96%
DPS
marksmanship Damage Per Second
Count 1217
Mean 9932.20
Minimum 9068.46
Maximum 10834.50
Spread ( max - min ) 1766.04
Range [ ( max - min ) / 2 * 100% ] 8.89%
Standard Deviation 298.7627
5th Percentile 9469.67
95th Percentile 10454.18
( 95th Percentile - 5th Percentile ) 984.51
Mean Distribution
Standard Deviation 8.5641
95.00% Confidence Interval ( 9915.42 - 9948.99 )
Normalized 95.00% Confidence Interval ( 99.83% - 100.17% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 35
0.1% Error 3476
0.1 Scale Factor Error with Delta=300 762
0.05 Scale Factor Error with Delta=300 3048
0.01 Scale Factor Error with Delta=300 76197
Priority Target DPS
marksmanship Priority Target Damage Per Second
Count 1217
Mean 3082.28
Minimum 2821.89
Maximum 3512.48
Spread ( max - min ) 690.59
Range [ ( max - min ) / 2 * 100% ] 11.20%
Standard Deviation 104.6259
5th Percentile 2921.20
95th Percentile 3266.61
( 95th Percentile - 5th Percentile ) 345.41
Mean Distribution
Standard Deviation 2.9991
95.00% Confidence Interval ( 3076.40 - 3088.16 )
Normalized 95.00% Confidence Interval ( 99.81% - 100.19% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 45
0.1% Error 4427
0.1 Scale Factor Error with Delta=300 94
0.05 Scale Factor Error with Delta=300 374
0.01 Scale Factor Error with Delta=300 9345
DPS(e)
marksmanship Damage Per Second (Effective)
Count 1217
Mean 9932.20
Minimum 9068.46
Maximum 10834.50
Spread ( max - min ) 1766.04
Range [ ( max - min ) / 2 * 100% ] 8.89%
Damage
marksmanship Damage
Count 1217
Mean 2975925.61
Minimum 2243837.19
Maximum 3627924.53
Spread ( max - min ) 1384087.34
Range [ ( max - min ) / 2 * 100% ] 23.25%
DTPS
marksmanship Damage Taken Per Second
Count 1217
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
marksmanship Healing Per Second
Count 1217
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
marksmanship Healing Per Second (Effective)
Count 1217
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
marksmanship Heal
Count 1217
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
marksmanship Healing Taken Per Second
Count 1217
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
marksmanship Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
marksmanshipTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
marksmanship Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask
1 0.00 augmentation
2 0.00 food
3 0.00 snapshot_stats
Snapshot raid buffed stats before combat begins and pre-potting is done.
4 0.00 tar_trap,if=runeforge.soulforge_embers
5 0.00 double_tap,precast_time=10,if=!covenant.kyrian&(!talent.volley|active_enemies<2)
6 0.00 aimed_shot,if=active_enemies<3
7 0.00 steady_shot,if=active_enemies>2
Default action list Executed every time the actor is available.
# count action,conditions
8 1.00 auto_shot
0.00 counter_shot,line_cd=30,if=runeforge.sephuzs_proclamation|soulbind.niyas_tools_poison|(conduit.reversal_of_fortune&!runeforge.sephuzs_proclamation)
9 3.74 use_items
A 0.00 call_action_list,name=cds
B 0.00 call_action_list,name=st,if=active_enemies<3
C 0.00 call_action_list,name=trickshots,if=active_enemies>2
actions.cds
# count action,conditions
0.00 berserking,if=buff.trueshot.up|target.time_to_die<13
D 2.98 blood_fury,if=buff.trueshot.up|target.time_to_die<16
0.00 ancestral_call,if=buff.trueshot.up|target.time_to_die<16
0.00 fireblood,if=buff.trueshot.up|target.time_to_die<9
0.00 lights_judgment,if=buff.trueshot.down
0.00 bag_of_tricks,if=buff.trueshot.down
E 1.48 potion,if=buff.trueshot.up&buff.bloodlust.up|buff.trueshot.up&target.health.pct<20|target.time_to_die<26
actions.trickshots
# count action,conditions
F 15.61 steady_shot,if=talent.steady_focus&in_flight&buff.steady_focus.remains<5
G 4.60 double_tap,if=covenant.kyrian&cooldown.resonating_arrow.remains<gcd|cooldown.rapid_fire.remains<cooldown.aimed_shot.full_recharge_time|!(talent.streamline&runeforge.surging_shots)|!covenant.kyrian
0.00 tar_trap,if=runeforge.soulforge_embers&tar_trap.remains<gcd&cooldown.flare.remains<gcd
0.00 flare,if=tar_trap.up&runeforge.soulforge_embers
0.00 explosive_shot
0.00 wild_spirits
0.00 resonating_arrow
0.00 volley
0.00 barrage
H 2.98 trueshot
0.00 rapid_fire,if=buff.trick_shots.remains>=execute_time&runeforge.surging_shots&buff.double_tap.down
I 46.55 aimed_shot,target_if=min:(dot.serpent_sting.remains<?action.serpent_sting.in_flight_to_target*dot.serpent_sting.duration),if=buff.trick_shots.remains>=execute_time&(buff.precise_shots.down|full_recharge_time<cast_time+gcd|buff.trueshot.up)
0.00 death_chakram,if=focus+cast_regen<focus.max
J 16.06 rapid_fire,if=buff.trick_shots.remains>=execute_time
K 73.51 multishot,if=buff.trick_shots.down|buff.precise_shots.up&focus>cost+action.aimed_shot.cost&(!talent.chimaera_shot|active_enemies>3)
0.00 chimaera_shot,if=buff.precise_shots.up&focus>cost+action.aimed_shot.cost&active_enemies<4
L 4.70 kill_shot,if=buff.dead_eye.down
0.00 a_murder_of_crows
0.00 flayed_shot
0.00 serpent_sting,target_if=min:dot.serpent_sting.remains,if=refreshable
M 8.55 multishot,if=focus>cost+action.aimed_shot.cost
N 53.67 steady_shot

Sample Sequence

0125789FHDEKIKIKIKJKIKNFIKINKJKNIKINFKNMNIKIKNNKIKJKNNIKGNNMIKIKNJKNFIKKIKNNKNIKJKNFI9KNMNMMIKNFJKNIGKNFMIKNHDMJKIKNFIKIKJKINFKNKIKNNIKJKNINFKNMIGKNNJKI9KNNMMIKNNNIKJKIKNFIKKIKNNKIKJKNNIKIKGNNKNIKHDJKIKNFIKINKINKJKNFIKNNK9IKNINKJKLNFIKGNLNKIKJKLNFIKNNKIKLNIKJEKILNFKNNKIKLNJKIKN

Sample Sequence Table

Time List # Name Target Resources Buffs
Pre precombat 0 flask marksmanship 100.0/100: 100% focus
Pre precombat 1 augmentation marksmanship 100.0/100: 100% focus
Pre precombat 2 food marksmanship 100.0/100: 100% focus
Pre precombat 5 double_tap Fluffy_Pillow 100.0/100: 100% focus
Pre precombat 7 steady_shot Fluffy_Pillow 100.0/100: 100% focus double_tap
0:00.000 default 8 auto_attack Fluffy_Pillow 100.0/100: 100% focus double_tap
0:00.000 default 9 use_items Fluffy_Pillow 100.0/100: 100% focus double_tap
0:00.000 trickshots F steady_shot Fluffy_Pillow 100.0/100: 100% focus double_tap
0:01.483 trickshots H trueshot Fluffy_Pillow 100.0/100: 100% focus bloodlust, double_tap, steady_focus
0:01.483 cds D blood_fury Fluffy_Pillow 100.0/100: 100% focus bloodlust, double_tap, steady_focus, trueshot
0:01.483 cds E potion Fluffy_Pillow 100.0/100: 100% focus bloodlust, blood_fury, double_tap, steady_focus, trueshot
0:01.483 trickshots K multishot Fluffy_Pillow 100.0/100: 100% focus bloodlust, blood_fury, double_tap, steady_focus, trueshot, potion_of_spectral_agility
0:02.399 trickshots I aimed_shot Fluffy_Pillow 91.3/100: 91% focus bloodlust, blood_fury, double_tap, steady_focus, trick_shots, trueshot, potion_of_spectral_agility
0:03.315 trickshots K multishot Fluffy_Pillow 66.9/100: 67% focus bloodlust, blood_fury, precise_shots, steady_focus, trueshot, potion_of_spectral_agility
0:04.232 trickshots I aimed_shot enemy2 58.3/100: 58% focus bloodlust, blood_fury, steady_focus, trick_shots, trueshot, potion_of_spectral_agility
0:05.148 trickshots K multishot Fluffy_Pillow 34.6/100: 35% focus bloodlust, blood_fury, lock_and_load, precise_shots(2), steady_focus, trueshot, potion_of_spectral_agility
0:06.064 trickshots I aimed_shot enemy3 25.9/100: 26% focus bloodlust, blood_fury, lock_and_load, precise_shots, steady_focus, trick_shots, trueshot, potion_of_spectral_agility
0:06.979 trickshots K multishot Fluffy_Pillow 37.2/100: 37% focus bloodlust, blood_fury, precise_shots(2), steady_focus, trueshot, potion_of_spectral_agility
0:07.895 trickshots J rapid_fire Fluffy_Pillow 28.5/100: 28% focus bloodlust, blood_fury, precise_shots, steady_focus, trick_shots, trueshot, potion_of_spectral_agility
0:09.382 trickshots K multishot Fluffy_Pillow 56.8/100: 57% focus bloodlust, blood_fury, precise_shots, steady_focus, trueshot, potion_of_spectral_agility
0:10.298 trickshots I aimed_shot enemy4 48.1/100: 48% focus bloodlust, blood_fury, steady_focus, trick_shots, trueshot, potion_of_spectral_agility
0:11.215 trickshots K multishot Fluffy_Pillow 24.4/100: 24% focus bloodlust, blood_fury, precise_shots, steady_focus, trueshot, potion_of_spectral_agility
0:12.131 trickshots N steady_shot Fluffy_Pillow 15.7/100: 16% focus bloodlust, blood_fury, steady_focus, trick_shots, trueshot, potion_of_spectral_agility
0:13.199 trickshots F steady_shot Fluffy_Pillow 43.9/100: 44% focus bloodlust, blood_fury, steady_focus, trick_shots, trueshot, potion_of_spectral_agility
0:14.265 trickshots I aimed_shot enemy5 72.1/100: 72% focus bloodlust, blood_fury, steady_focus, trick_shots, trueshot, potion_of_spectral_agility
0:15.182 trickshots K multishot Fluffy_Pillow 48.4/100: 48% focus bloodlust, blood_fury, precise_shots(2), steady_focus, trueshot, potion_of_spectral_agility
0:16.097 trickshots I aimed_shot Fluffy_Pillow 39.7/100: 40% focus bloodlust, blood_fury, precise_shots, steady_focus, trick_shots, trueshot, potion_of_spectral_agility
0:17.012 trickshots N steady_shot Fluffy_Pillow 13.8/100: 14% focus bloodlust, precise_shots(2), steady_focus, potion_of_spectral_agility
0:18.079 trickshots K multishot Fluffy_Pillow 32.6/100: 33% focus bloodlust, precise_shots(2), steady_focus, potion_of_spectral_agility
0:18.995 trickshots J rapid_fire Fluffy_Pillow 20.1/100: 20% focus bloodlust, precise_shots, steady_focus, trick_shots, potion_of_spectral_agility
0:20.396 trickshots K multishot Fluffy_Pillow 38.7/100: 39% focus bloodlust, precise_shots, steady_focus, potion_of_spectral_agility
0:21.313 trickshots N steady_shot Fluffy_Pillow 26.2/100: 26% focus bloodlust, steady_focus, trick_shots, potion_of_spectral_agility
0:22.381 trickshots I aimed_shot enemy2 45.0/100: 45% focus bloodlust, steady_focus, trick_shots, potion_of_spectral_agility
0:23.905 trickshots K multishot Fluffy_Pillow 22.5/100: 23% focus bloodlust, lock_and_load, precise_shots, steady_focus, potion_of_spectral_agility
0:24.821 trickshots I aimed_shot enemy3 10.1/100: 10% focus bloodlust, lock_and_load, steady_focus, trick_shots, potion_of_spectral_agility
0:25.736 trickshots N steady_shot Fluffy_Pillow 17.6/100: 18% focus bloodlust, precise_shots, steady_focus, potion_of_spectral_agility
0:26.804 trickshots F steady_shot Fluffy_Pillow 36.4/100: 36% focus bloodlust, precise_shots, steady_focus
0:27.873 trickshots K multishot Fluffy_Pillow 55.2/100: 55% focus bloodlust, precise_shots, steady_focus
0:28.789 trickshots N steady_shot Fluffy_Pillow 42.7/100: 43% focus bloodlust, steady_focus, trick_shots
0:29.857 trickshots M multishot Fluffy_Pillow 61.5/100: 61% focus bloodlust, steady_focus, trick_shots
0:30.771 trickshots N steady_shot Fluffy_Pillow 49.0/100: 49% focus bloodlust, steady_focus, trick_shots
0:31.840 trickshots I aimed_shot enemy4 67.8/100: 68% focus bloodlust, steady_focus, trick_shots
0:33.364 trickshots K multishot Fluffy_Pillow 45.4/100: 45% focus bloodlust, precise_shots, steady_focus
0:34.280 trickshots I aimed_shot enemy5 32.9/100: 33% focus bloodlust, lock_and_load, steady_focus, trick_shots
0:35.197 trickshots K multishot Fluffy_Pillow 40.4/100: 40% focus bloodlust, precise_shots(2), steady_focus
0:36.113 trickshots N steady_shot Fluffy_Pillow 28.0/100: 28% focus bloodlust, precise_shots, steady_focus, trick_shots
0:37.180 trickshots N steady_shot Fluffy_Pillow 46.8/100: 47% focus bloodlust, precise_shots, steady_focus, trick_shots
0:38.248 trickshots K multishot Fluffy_Pillow 65.5/100: 66% focus bloodlust, precise_shots, steady_focus, trick_shots
0:39.162 trickshots I aimed_shot Fluffy_Pillow 53.1/100: 53% focus bloodlust, steady_focus, trick_shots
0:40.685 trickshots K multishot Fluffy_Pillow 30.6/100: 31% focus bloodlust, precise_shots(2), steady_focus
0:41.600 trickshots J rapid_fire Fluffy_Pillow 17.0/100: 17% focus precise_shots, steady_focus, trick_shots
0:43.403 trickshots K multishot Fluffy_Pillow 35.4/100: 35% focus precise_shots, steady_focus
0:44.591 trickshots N steady_shot Fluffy_Pillow 22.9/100: 23% focus steady_focus, trick_shots
0:45.979 trickshots N steady_shot Fluffy_Pillow 41.7/100: 42% focus steady_focus, trick_shots
0:47.365 trickshots I aimed_shot enemy2 60.5/100: 60% focus steady_focus, trick_shots
0:49.345 trickshots K multishot Fluffy_Pillow 38.0/100: 38% focus precise_shots, steady_focus
0:50.533 trickshots G double_tap Fluffy_Pillow 25.5/100: 26% focus steady_focus, trick_shots
0:51.720 trickshots N steady_shot Fluffy_Pillow 33.0/100: 33% focus double_tap, steady_focus, trick_shots
0:53.106 trickshots N steady_shot Fluffy_Pillow 51.8/100: 52% focus double_tap, steady_focus, trick_shots
0:54.493 trickshots M multishot Fluffy_Pillow 70.6/100: 71% focus double_tap, steady_focus, trick_shots
0:55.683 trickshots I aimed_shot enemy3 58.1/100: 58% focus double_tap, lock_and_load, steady_focus, trick_shots
0:56.871 trickshots K multishot Fluffy_Pillow 65.6/100: 66% focus precise_shots, steady_focus
0:58.060 trickshots I aimed_shot enemy4 53.2/100: 53% focus steady_focus, trick_shots
1:00.038 trickshots K multishot Fluffy_Pillow 30.7/100: 31% focus precise_shots(2), steady_focus
1:01.227 trickshots N steady_shot Fluffy_Pillow 18.2/100: 18% focus precise_shots, steady_focus, trick_shots
1:02.614 trickshots J rapid_fire Fluffy_Pillow 37.0/100: 37% focus precise_shots, steady_focus, trick_shots
1:04.415 trickshots K multishot Fluffy_Pillow 55.4/100: 55% focus precise_shots, steady_focus
1:05.605 trickshots N steady_shot Fluffy_Pillow 42.9/100: 43% focus steady_focus, trick_shots
1:06.993 trickshots F steady_shot Fluffy_Pillow 61.7/100: 62% focus steady_focus, trick_shots
1:08.381 trickshots I aimed_shot Fluffy_Pillow 80.5/100: 80% focus steady_focus, trick_shots
1:10.360 trickshots K multishot Fluffy_Pillow 58.0/100: 58% focus lock_and_load, precise_shots(2), steady_focus
1:11.548 trickshots K multishot Fluffy_Pillow 45.5/100: 46% focus lock_and_load, precise_shots, steady_focus, trick_shots
1:12.737 trickshots I aimed_shot enemy2 33.1/100: 33% focus lock_and_load, steady_focus, trick_shots
1:13.924 trickshots K multishot Fluffy_Pillow 40.6/100: 41% focus precise_shots(2), steady_focus
1:15.110 trickshots N steady_shot Fluffy_Pillow 28.1/100: 28% focus precise_shots, steady_focus, trick_shots
1:16.496 trickshots N steady_shot Fluffy_Pillow 46.8/100: 47% focus precise_shots, steady_focus, trick_shots
1:17.882 trickshots K multishot Fluffy_Pillow 65.6/100: 66% focus precise_shots, steady_focus, trick_shots
1:19.070 trickshots N steady_shot Fluffy_Pillow 53.1/100: 53% focus steady_focus, trick_shots
1:20.456 trickshots I aimed_shot enemy3 71.9/100: 72% focus steady_focus, trick_shots
1:22.434 trickshots K multishot Fluffy_Pillow 49.4/100: 49% focus precise_shots, steady_focus
1:23.622 trickshots J rapid_fire Fluffy_Pillow 36.9/100: 37% focus steady_focus, trick_shots
1:25.416 trickshots K multishot Fluffy_Pillow 55.3/100: 55% focus steady_focus
1:26.605 trickshots N steady_shot Fluffy_Pillow 42.8/100: 43% focus steady_focus, trick_shots
1:27.990 trickshots F steady_shot Fluffy_Pillow 61.6/100: 62% focus steady_focus, trick_shots
1:29.375 trickshots I aimed_shot Fluffy_Pillow 80.4/100: 80% focus steady_focus, trick_shots
1:31.354 default 9 use_items Fluffy_Pillow 57.9/100: 58% focus precise_shots, steady_focus
1:31.354 trickshots K multishot Fluffy_Pillow 57.9/100: 58% focus precise_shots, steady_focus
1:32.542 trickshots N steady_shot Fluffy_Pillow 45.4/100: 45% focus steady_focus, trick_shots
1:33.928 trickshots M multishot Fluffy_Pillow 64.2/100: 64% focus steady_focus, trick_shots
1:35.117 trickshots N steady_shot Fluffy_Pillow 51.7/100: 52% focus steady_focus, trick_shots
1:36.503 trickshots M multishot Fluffy_Pillow 70.5/100: 70% focus steady_focus, trick_shots
1:37.692 trickshots M multishot Fluffy_Pillow 58.0/100: 58% focus steady_focus, trick_shots
1:38.881 trickshots I aimed_shot enemy2 45.5/100: 46% focus steady_focus, trick_shots
1:40.860 trickshots K multishot Fluffy_Pillow 23.0/100: 23% focus precise_shots, steady_focus
1:42.048 trickshots N steady_shot Fluffy_Pillow 10.6/100: 11% focus steady_focus, trick_shots
1:43.433 trickshots F steady_shot Fluffy_Pillow 29.3/100: 29% focus steady_focus, trick_shots
1:44.820 trickshots J rapid_fire Fluffy_Pillow 47.9/100: 48% focus steady_focus, trick_shots
1:46.646 trickshots K multishot Fluffy_Pillow 66.5/100: 66% focus steady_focus
1:47.836 trickshots N steady_shot Fluffy_Pillow 54.0/100: 54% focus steady_focus, trick_shots
1:49.222 trickshots I aimed_shot enemy3 72.8/100: 73% focus steady_focus, trick_shots
1:51.201 trickshots G double_tap Fluffy_Pillow 50.3/100: 50% focus precise_shots, steady_focus
1:52.389 trickshots K multishot Fluffy_Pillow 57.8/100: 58% focus double_tap, precise_shots, steady_focus
1:53.579 trickshots N steady_shot Fluffy_Pillow 45.4/100: 45% focus double_tap, steady_focus, trick_shots
1:54.966 trickshots F steady_shot Fluffy_Pillow 64.1/100: 64% focus double_tap, steady_focus, trick_shots
1:56.353 trickshots M multishot Fluffy_Pillow 82.9/100: 83% focus double_tap, steady_focus, trick_shots
1:57.541 trickshots I aimed_shot Fluffy_Pillow 70.4/100: 70% focus double_tap, steady_focus, trick_shots
1:59.756 trickshots K multishot Fluffy_Pillow 49.5/100: 49% focus precise_shots, steady_focus
2:00.945 trickshots N steady_shot Fluffy_Pillow 37.0/100: 37% focus steady_focus, trick_shots
2:02.333 trickshots H trueshot Fluffy_Pillow 55.8/100: 56% focus steady_focus, trick_shots
2:02.333 cds D blood_fury Fluffy_Pillow 55.8/100: 56% focus steady_focus, trick_shots, trueshot
2:02.333 trickshots M multishot Fluffy_Pillow 55.8/100: 56% focus blood_fury, steady_focus, trick_shots, trueshot
2:03.522 trickshots J rapid_fire Fluffy_Pillow 47.1/100: 47% focus blood_fury, steady_focus, trick_shots, trueshot
2:05.304 trickshots K multishot Fluffy_Pillow 74.0/100: 74% focus blood_fury, steady_focus, trueshot
2:06.493 trickshots I aimed_shot enemy2 65.3/100: 65% focus blood_fury, steady_focus, trick_shots, trueshot
2:07.682 trickshots K multishot Fluffy_Pillow 41.6/100: 42% focus blood_fury, precise_shots, steady_focus, trueshot
2:08.869 trickshots N steady_shot Fluffy_Pillow 32.8/100: 33% focus blood_fury, steady_focus, trick_shots, trueshot
2:10.259 trickshots F steady_shot Fluffy_Pillow 61.0/100: 61% focus blood_fury, steady_focus, trick_shots, trueshot
2:11.645 trickshots I aimed_shot enemy3 89.0/100: 89% focus blood_fury, steady_focus, trick_shots, trueshot
2:12.832 trickshots K multishot Fluffy_Pillow 65.3/100: 65% focus blood_fury, precise_shots(2), steady_focus, trueshot
2:14.020 trickshots I aimed_shot enemy4 56.5/100: 57% focus blood_fury, precise_shots, steady_focus, trick_shots, trueshot
2:15.209 trickshots K multishot Fluffy_Pillow 32.8/100: 33% focus blood_fury, precise_shots(2), steady_focus, trueshot
2:16.396 trickshots J rapid_fire Fluffy_Pillow 24.1/100: 24% focus blood_fury, precise_shots, steady_focus, trick_shots, trueshot
2:18.203 trickshots K multishot Fluffy_Pillow 48.5/100: 49% focus precise_shots, steady_focus
2:19.391 trickshots I aimed_shot enemy5 36.0/100: 36% focus steady_focus, trick_shots
2:21.369 trickshots N steady_shot Fluffy_Pillow 13.5/100: 14% focus precise_shots(2), steady_focus
2:22.756 trickshots F steady_shot Fluffy_Pillow 32.3/100: 32% focus precise_shots(2), steady_focus
2:24.141 trickshots K multishot Fluffy_Pillow 51.1/100: 51% focus precise_shots(2), steady_focus
2:25.329 trickshots N steady_shot Fluffy_Pillow 38.6/100: 39% focus precise_shots, steady_focus, trick_shots
2:26.715 trickshots K multishot Fluffy_Pillow 57.4/100: 57% focus precise_shots, steady_focus, trick_shots
2:27.904 trickshots I aimed_shot Fluffy_Pillow 44.9/100: 45% focus steady_focus, trick_shots
2:29.883 trickshots K multishot Fluffy_Pillow 22.4/100: 22% focus precise_shots, steady_focus
2:31.072 trickshots N steady_shot Fluffy_Pillow 10.0/100: 10% focus steady_focus, trick_shots
2:32.458 trickshots N steady_shot Fluffy_Pillow 28.7/100: 29% focus steady_focus, trick_shots
2:33.844 trickshots I aimed_shot enemy2 47.5/100: 47% focus steady_focus, trick_shots
2:35.824 trickshots K multishot Fluffy_Pillow 25.0/100: 25% focus precise_shots(2), steady_focus
2:37.013 trickshots J rapid_fire Fluffy_Pillow 12.6/100: 13% focus precise_shots, steady_focus, trick_shots
2:38.801 trickshots K multishot Fluffy_Pillow 30.9/100: 31% focus precise_shots, steady_focus
2:39.988 trickshots N steady_shot Fluffy_Pillow 18.4/100: 18% focus steady_focus, trick_shots
2:41.376 trickshots I aimed_shot enemy3 37.2/100: 37% focus steady_focus, trick_shots
2:43.357 trickshots N steady_shot Fluffy_Pillow 14.7/100: 15% focus precise_shots, steady_focus
2:44.744 trickshots F steady_shot Fluffy_Pillow 33.5/100: 33% focus precise_shots, steady_focus
2:46.130 trickshots K multishot Fluffy_Pillow 52.3/100: 52% focus precise_shots, steady_focus
2:47.318 trickshots N steady_shot Fluffy_Pillow 39.8/100: 40% focus steady_focus, trick_shots
2:48.704 trickshots M multishot Fluffy_Pillow 58.6/100: 59% focus steady_focus, trick_shots
2:49.894 trickshots I aimed_shot Fluffy_Pillow 46.1/100: 46% focus steady_focus, trick_shots
2:51.873 trickshots G double_tap Fluffy_Pillow 23.6/100: 24% focus precise_shots, steady_focus
2:53.062 trickshots K multishot Fluffy_Pillow 31.1/100: 31% focus double_tap, precise_shots, steady_focus
2:54.251 trickshots N steady_shot Fluffy_Pillow 18.7/100: 19% focus double_tap, steady_focus, trick_shots
2:55.637 trickshots N steady_shot Fluffy_Pillow 37.4/100: 37% focus double_tap, steady_focus, trick_shots
2:57.023 trickshots J rapid_fire Fluffy_Pillow 56.2/100: 56% focus double_tap, steady_focus, trick_shots
2:59.033 trickshots K multishot Fluffy_Pillow 82.9/100: 83% focus steady_focus
3:00.222 trickshots I aimed_shot enemy2 70.5/100: 70% focus steady_focus, trick_shots
3:02.202 default 9 use_items Fluffy_Pillow 48.0/100: 48% focus precise_shots, steady_focus
3:02.202 trickshots K multishot Fluffy_Pillow 48.0/100: 48% focus precise_shots, steady_focus
3:03.390 trickshots N steady_shot Fluffy_Pillow 35.5/100: 36% focus steady_focus, trick_shots
3:04.777 trickshots N steady_shot Fluffy_Pillow 54.3/100: 54% focus steady_focus, trick_shots
3:06.162 trickshots M multishot Fluffy_Pillow 73.0/100: 73% focus steady_focus, trick_shots
3:07.350 trickshots M multishot Fluffy_Pillow 60.6/100: 61% focus steady_focus, trick_shots
3:08.539 trickshots I aimed_shot enemy3 48.1/100: 48% focus steady_focus, trick_shots
3:10.741 trickshots K multishot Fluffy_Pillow 27.0/100: 27% focus precise_shots, steady_focus
3:11.926 trickshots N steady_shot Fluffy_Pillow 14.5/100: 15% focus steady_focus, trick_shots
3:13.313 trickshots N steady_shot Fluffy_Pillow 33.3/100: 33% focus steady_focus, trick_shots
3:14.699 trickshots N steady_shot Fluffy_Pillow 52.1/100: 52% focus steady_focus, trick_shots
3:16.085 trickshots I aimed_shot Fluffy_Pillow 70.9/100: 71% focus lock_and_load, steady_focus, trick_shots
3:17.276 trickshots K multishot Fluffy_Pillow 78.4/100: 78% focus precise_shots(2), steady_focus
3:18.466 trickshots J rapid_fire Fluffy_Pillow 65.9/100: 66% focus precise_shots, steady_focus, trick_shots
3:20.251 trickshots K multishot Fluffy_Pillow 84.2/100: 84% focus precise_shots, steady_focus
3:21.440 trickshots I aimed_shot enemy4 71.7/100: 72% focus steady_focus, trick_shots
3:23.419 trickshots K multishot Fluffy_Pillow 49.3/100: 49% focus precise_shots(2), steady_focus
3:24.607 trickshots N steady_shot Fluffy_Pillow 36.8/100: 37% focus precise_shots, steady_focus, trick_shots
3:25.992 trickshots F steady_shot Fluffy_Pillow 55.6/100: 56% focus lock_and_load, precise_shots, steady_focus, trick_shots
3:27.378 trickshots I aimed_shot enemy2 74.3/100: 74% focus lock_and_load, precise_shots, steady_focus, trick_shots
3:28.566 trickshots K multishot Fluffy_Pillow 81.8/100: 82% focus precise_shots(2), steady_focus
3:29.754 trickshots K multishot Fluffy_Pillow 69.4/100: 69% focus precise_shots, steady_focus, trick_shots
3:30.942 trickshots I aimed_shot enemy5 56.9/100: 57% focus steady_focus, trick_shots
3:32.920 trickshots K multishot Fluffy_Pillow 34.4/100: 34% focus precise_shots(2), steady_focus
3:34.108 trickshots N steady_shot Fluffy_Pillow 21.9/100: 22% focus precise_shots, steady_focus, trick_shots
3:35.495 trickshots N steady_shot Fluffy_Pillow 40.7/100: 41% focus precise_shots, steady_focus, trick_shots
3:36.883 trickshots K multishot Fluffy_Pillow 59.5/100: 59% focus precise_shots, steady_focus, trick_shots
3:38.073 trickshots I aimed_shot Fluffy_Pillow 47.0/100: 47% focus steady_focus, trick_shots
3:40.051 trickshots K multishot Fluffy_Pillow 24.5/100: 25% focus precise_shots, steady_focus
3:41.239 trickshots J rapid_fire Fluffy_Pillow 12.1/100: 12% focus steady_focus, trick_shots
3:43.087 trickshots K multishot Fluffy_Pillow 30.8/100: 31% focus steady_focus
3:44.276 trickshots N steady_shot Fluffy_Pillow 18.3/100: 18% focus steady_focus, trick_shots
3:45.661 trickshots N steady_shot Fluffy_Pillow 37.0/100: 37% focus steady_focus, trick_shots
3:47.047 trickshots I aimed_shot enemy2 55.8/100: 56% focus steady_focus, trick_shots
3:49.026 trickshots K multishot Fluffy_Pillow 33.3/100: 33% focus lock_and_load, precise_shots, steady_focus
3:50.217 trickshots I aimed_shot enemy3 20.9/100: 21% focus lock_and_load, steady_focus, trick_shots
3:51.404 trickshots K multishot Fluffy_Pillow 28.4/100: 28% focus precise_shots(2), steady_focus
3:52.593 trickshots G double_tap Fluffy_Pillow 15.9/100: 16% focus precise_shots, steady_focus, trick_shots
3:53.784 trickshots N steady_shot Fluffy_Pillow 23.5/100: 23% focus double_tap, precise_shots, steady_focus, trick_shots
3:55.170 trickshots N steady_shot Fluffy_Pillow 42.2/100: 42% focus double_tap, precise_shots, steady_focus, trick_shots
3:56.556 trickshots K multishot Fluffy_Pillow 61.0/100: 61% focus double_tap, precise_shots, steady_focus, trick_shots
3:57.745 trickshots N steady_shot Fluffy_Pillow 48.5/100: 49% focus double_tap, steady_focus, trick_shots
3:59.130 trickshots I aimed_shot Fluffy_Pillow 67.3/100: 67% focus double_tap, steady_focus, trick_shots
4:01.109 trickshots K multishot Fluffy_Pillow 44.8/100: 45% focus precise_shots(2), steady_focus
4:02.297 trickshots H trueshot Fluffy_Pillow 32.3/100: 32% focus precise_shots, steady_focus, trick_shots
4:02.333 cds D blood_fury Fluffy_Pillow 32.6/100: 33% focus precise_shots, steady_focus, trick_shots, trueshot
4:02.333 trickshots J rapid_fire Fluffy_Pillow 32.6/100: 33% focus blood_fury, precise_shots, steady_focus, trick_shots, trueshot
4:04.154 trickshots K multishot Fluffy_Pillow 58.9/100: 59% focus blood_fury, precise_shots, steady_focus, trueshot
4:05.342 trickshots I aimed_shot enemy4 50.1/100: 50% focus blood_fury, steady_focus, trick_shots, trueshot
4:06.531 trickshots K multishot Fluffy_Pillow 26.4/100: 26% focus blood_fury, precise_shots, steady_focus, trueshot
4:07.719 trickshots N steady_shot Fluffy_Pillow 17.7/100: 18% focus blood_fury, steady_focus, trick_shots, trueshot
4:09.105 trickshots F steady_shot Fluffy_Pillow 45.9/100: 46% focus blood_fury, steady_focus, trick_shots, trueshot
4:10.491 trickshots I aimed_shot enemy2 74.0/100: 74% focus blood_fury, steady_focus, trick_shots, trueshot
4:11.678 trickshots K multishot Fluffy_Pillow 50.3/100: 50% focus blood_fury, precise_shots, steady_focus, trueshot
4:12.865 trickshots I aimed_shot enemy3 41.6/100: 42% focus blood_fury, steady_focus, trick_shots, trueshot
4:14.056 trickshots N steady_shot Fluffy_Pillow 17.9/100: 18% focus blood_fury, precise_shots(2), steady_focus, trueshot
4:15.441 trickshots K multishot Fluffy_Pillow 46.0/100: 46% focus blood_fury, precise_shots(2), steady_focus, trueshot
4:16.629 trickshots I aimed_shot enemy5 37.3/100: 37% focus blood_fury, precise_shots, steady_focus, trick_shots, trueshot
4:17.817 trickshots N steady_shot Fluffy_Pillow 12.0/100: 12% focus precise_shots(2), steady_focus
4:19.204 trickshots K multishot Fluffy_Pillow 30.8/100: 31% focus precise_shots(2), steady_focus
4:20.391 trickshots J rapid_fire Fluffy_Pillow 18.3/100: 18% focus precise_shots, steady_focus, trick_shots
4:22.181 trickshots K multishot Fluffy_Pillow 36.7/100: 37% focus precise_shots, steady_focus
4:23.371 trickshots N steady_shot Fluffy_Pillow 24.2/100: 24% focus steady_focus, trick_shots
4:24.758 trickshots F steady_shot Fluffy_Pillow 43.0/100: 43% focus steady_focus, trick_shots
4:26.143 trickshots I aimed_shot Fluffy_Pillow 61.5/100: 61% focus steady_focus, trick_shots
4:28.121 trickshots K multishot Fluffy_Pillow 39.0/100: 39% focus precise_shots(2), steady_focus
4:29.308 trickshots N steady_shot Fluffy_Pillow 26.5/100: 26% focus precise_shots, steady_focus, trick_shots
4:30.695 trickshots N steady_shot Fluffy_Pillow 45.3/100: 45% focus precise_shots, steady_focus, trick_shots
4:32.082 trickshots K multishot Fluffy_Pillow 64.1/100: 64% focus precise_shots, steady_focus, trick_shots
4:33.271 default 9 use_items Fluffy_Pillow 51.6/100: 52% focus steady_focus, trick_shots
4:33.271 trickshots I aimed_shot enemy2 51.6/100: 52% focus steady_focus, trick_shots
4:35.249 trickshots K multishot Fluffy_Pillow 29.1/100: 29% focus precise_shots, steady_focus
4:36.437 trickshots N steady_shot Fluffy_Pillow 16.6/100: 17% focus steady_focus, trick_shots
4:37.823 trickshots I aimed_shot enemy3 35.4/100: 35% focus steady_focus, trick_shots
4:39.802 trickshots N steady_shot Fluffy_Pillow 12.9/100: 13% focus precise_shots, steady_focus
4:41.187 trickshots K multishot Fluffy_Pillow 31.7/100: 32% focus precise_shots, steady_focus
4:42.375 trickshots J rapid_fire Fluffy_Pillow 19.2/100: 19% focus steady_focus, trick_shots
4:44.309 trickshots K multishot Fluffy_Pillow 38.4/100: 38% focus steady_focus
4:45.496 trickshots L kill_shot Fluffy_Pillow 26.0/100: 26% focus steady_focus, trick_shots
4:46.685 trickshots N steady_shot Fluffy_Pillow 23.5/100: 23% focus steady_focus, trick_shots
4:48.072 trickshots F steady_shot Fluffy_Pillow 41.8/100: 42% focus trick_shots
4:49.556 trickshots I aimed_shot Fluffy_Pillow 60.6/100: 61% focus steady_focus, trick_shots
4:51.533 trickshots K multishot Fluffy_Pillow 38.1/100: 38% focus precise_shots(2), steady_focus
4:52.720 trickshots G double_tap Fluffy_Pillow 25.6/100: 26% focus precise_shots, steady_focus, trick_shots
4:53.909 trickshots N steady_shot Fluffy_Pillow 33.2/100: 33% focus double_tap, precise_shots, steady_focus, trick_shots
4:55.297 trickshots L kill_shot Fluffy_Pillow 52.0/100: 52% focus double_tap, precise_shots, steady_focus, trick_shots
4:56.686 trickshots N steady_shot Fluffy_Pillow 50.8/100: 51% focus double_tap, precise_shots, steady_focus, trick_shots
4:58.073 trickshots K multishot Fluffy_Pillow 69.5/100: 70% focus double_tap, precise_shots, steady_focus, trick_shots
4:59.261 trickshots I aimed_shot enemy2 57.0/100: 57% focus double_tap, steady_focus, trick_shots
5:01.238 trickshots K multishot Fluffy_Pillow 34.6/100: 35% focus precise_shots(2), steady_focus
5:02.425 trickshots J rapid_fire Fluffy_Pillow 22.1/100: 22% focus precise_shots, steady_focus, trick_shots
5:04.326 trickshots K multishot Fluffy_Pillow 41.1/100: 41% focus precise_shots, steady_focus
5:05.515 trickshots L kill_shot Fluffy_Pillow 28.2/100: 28% focus trick_shots
5:06.787 trickshots N steady_shot Fluffy_Pillow 25.8/100: 26% focus trick_shots
5:08.271 trickshots F steady_shot Fluffy_Pillow 44.5/100: 45% focus trick_shots
5:09.755 trickshots I aimed_shot enemy3 63.3/100: 63% focus steady_focus, trick_shots
5:11.734 trickshots K multishot Fluffy_Pillow 40.8/100: 41% focus precise_shots(2), steady_focus
5:12.923 trickshots N steady_shot Fluffy_Pillow 28.4/100: 28% focus precise_shots, steady_focus, trick_shots
5:14.308 trickshots N steady_shot Fluffy_Pillow 47.1/100: 47% focus precise_shots, steady_focus, trick_shots
5:15.695 trickshots K multishot Fluffy_Pillow 65.9/100: 66% focus precise_shots, steady_focus, trick_shots
5:16.885 trickshots I aimed_shot Fluffy_Pillow 53.4/100: 53% focus steady_focus, trick_shots
5:18.864 trickshots K multishot Fluffy_Pillow 31.0/100: 31% focus precise_shots, steady_focus
5:20.052 trickshots L kill_shot Fluffy_Pillow 18.5/100: 18% focus steady_focus, trick_shots
5:21.240 trickshots N steady_shot Fluffy_Pillow 16.0/100: 16% focus steady_focus, trick_shots
5:22.626 trickshots I aimed_shot enemy2 34.8/100: 35% focus lock_and_load, steady_focus, trick_shots
5:23.815 trickshots K multishot Fluffy_Pillow 42.3/100: 42% focus precise_shots, steady_focus
5:25.005 trickshots J rapid_fire Fluffy_Pillow 29.8/100: 30% focus steady_focus, trick_shots
5:26.830 cds E potion Fluffy_Pillow 48.4/100: 48% focus steady_focus
5:26.830 trickshots K multishot Fluffy_Pillow 48.4/100: 48% focus steady_focus, potion_of_spectral_agility
5:28.020 trickshots I aimed_shot enemy4 35.9/100: 36% focus steady_focus, trick_shots, potion_of_spectral_agility
5:29.997 trickshots L kill_shot Fluffy_Pillow 13.4/100: 13% focus precise_shots(2), steady_focus, potion_of_spectral_agility
5:31.239 trickshots N steady_shot Fluffy_Pillow 11.1/100: 11% focus precise_shots(2), potion_of_spectral_agility
5:32.723 trickshots F steady_shot Fluffy_Pillow 29.8/100: 30% focus precise_shots(2), potion_of_spectral_agility
5:34.205 trickshots K multishot Fluffy_Pillow 48.6/100: 49% focus precise_shots(2), steady_focus, potion_of_spectral_agility
5:35.394 trickshots N steady_shot Fluffy_Pillow 36.1/100: 36% focus precise_shots, steady_focus, trick_shots, potion_of_spectral_agility
5:36.780 trickshots N steady_shot Fluffy_Pillow 54.9/100: 55% focus precise_shots, steady_focus, trick_shots, potion_of_spectral_agility
5:38.167 trickshots K multishot Fluffy_Pillow 73.7/100: 74% focus precise_shots, steady_focus, trick_shots, potion_of_spectral_agility
5:39.356 trickshots I aimed_shot enemy3 61.2/100: 61% focus steady_focus, trick_shots, potion_of_spectral_agility
5:41.335 trickshots K multishot Fluffy_Pillow 38.7/100: 39% focus precise_shots(2), steady_focus, potion_of_spectral_agility
5:42.523 trickshots L kill_shot Fluffy_Pillow 26.3/100: 26% focus precise_shots, steady_focus, trick_shots, potion_of_spectral_agility
5:43.712 trickshots N steady_shot Fluffy_Pillow 23.8/100: 24% focus precise_shots, steady_focus, trick_shots, potion_of_spectral_agility
5:45.099 trickshots J rapid_fire Fluffy_Pillow 42.6/100: 43% focus precise_shots, steady_focus, trick_shots, potion_of_spectral_agility
5:46.888 trickshots K multishot Fluffy_Pillow 60.9/100: 61% focus precise_shots, steady_focus, potion_of_spectral_agility
5:48.077 trickshots I aimed_shot Fluffy_Pillow 48.4/100: 48% focus steady_focus, trick_shots, potion_of_spectral_agility
5:50.056 trickshots K multishot Fluffy_Pillow 25.9/100: 26% focus precise_shots, steady_focus, potion_of_spectral_agility
5:51.244 trickshots N steady_shot Fluffy_Pillow 13.5/100: 13% focus steady_focus, trick_shots, potion_of_spectral_agility

Stats

Level Bonus (60) Race Bonus (orc) Raid-Buffed Unbuffed Gear Amount
Strength 274 3 295 277 0
Agility 450 -3 1411 1297 789 (677)
Stamina 414 1 1800 1715 1300
Intellect 369 -1 405 368 0
Spirit 0 0 0 0 0
Health 36000 34300 0
Focus 100 100 0
Spell Power 405 368 0
Crit 22.66% 22.66% 443
Haste 18.30% 18.30% 604
Versatility 3.65% 3.65% 146
Attack Power 1482 1297 0
Mastery 14.00% 14.00% 504
Armor 818 818 818
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 217.00
Local Head Helm of Insatiable Appetite
ilevel: 213, stats: { 103 Armor, +126 Sta, +92 Haste, +40 Mastery, +72 AgiInt }
Local Neck Noble's Birthstone Pendant
ilevel: 213, stats: { +71 Sta, +47 Crit, +147 Mastery }
Local Shoulders Boneshatter Pauldrons
ilevel: 235, stats: { 107 Armor, +124 Sta, +44 unknown(24), +44 unknown(25), +66 AgiInt }
item effects: { equip: Serpentstalker's Trickery }
Local Chest Master Huntsman's Bandolier
ilevel: 213, stats: { 137 Armor, +126 Sta, +45 Crit, +86 Mastery, +72 AgiInt }, enchant: { +20 StrAgi }
Local Waist Load-Bearing Belt
ilevel: 213, stats: { 77 Armor, +95 Sta, +69 Haste, +30 Vers, +54 AgiInt }
Local Legs Greaves of Enigmatic Energies
ilevel: 213, stats: { 120 Armor, +126 Sta, +91 Crit, +41 Mastery, +72 AgiInt }
Local Feet Stoneclas Stompers
ilevel: 213, stats: { 86 Armor, +95 Sta, +69 Crit, +30 Mastery, +54 AgiInt }, enchant: { +15 Agi }
Local Wrists Bangles of Errant Pride
ilevel: 213, stats: { 69 Armor, +71 Sta, +48 Crit, +24 Mastery, +40 AgiInt }
Local Hands Oathsworn Soldier's Gauntlets
ilevel: 220, stats: { 80 Armor, +104 Sta, +67 Crit, +36 Haste, +58 AgiInt }
Local Finger1 Most Regal Signet of Sire Denathrius
ilevel: 220, stats: { +77 Sta, +161 Haste, +44 Mastery }, enchant: { +16 Crit }
item effects: { equip: Denathrius' Privilege }
Local Finger2 Ritualist's Treasured Ring
ilevel: 213, stats: { +71 Sta, +44 Crit, +149 Haste }, enchant: { +16 Crit }
Local Trinket1 Dreadfire Vessel
ilevel: 220, stats: { +73 StrAgiInt }, enchant: shadowcore_oil
item effects: { use: Dreadfire Vessel }
Local Trinket2 Stone Legion Heraldry
ilevel: 220, stats: { +73 StrAgi }
item effects: { equip: Stone Legionnaire }
Local Back Crest of the Legionnaire General
ilevel: 220, stats: { 39 Armor, +77 Sta, +52 Haste, +24 Vers, +43 StrAgiInt }
Local Main Hand Deadeye Blunderbuss
ilevel: 220, weapon: { 121 - 227, 3 }, stats: { +77 Agi, +137 Sta, +45 Haste, +92 Mastery }, enchant: sinful_revelation

Profile

hunter="marksmanship"
source=default
spec=marksmanship
level=60
race=orc
role=attack
position=ranged_back
talents=1101032

# Default consumables
potion=spectral_agility
flask=spectral_flask_of_power
food=feast_of_gluttonous_hedonism
augmentation=veiled

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask
actions.precombat+=/augmentation
actions.precombat+=/food
# Snapshot raid buffed stats before combat begins and pre-potting is done.
actions.precombat+=/snapshot_stats
actions.precombat+=/tar_trap,if=runeforge.soulforge_embers
actions.precombat+=/double_tap,precast_time=10,if=!covenant.kyrian&(!talent.volley|active_enemies<2)
actions.precombat+=/aimed_shot,if=active_enemies<3
actions.precombat+=/steady_shot,if=active_enemies>2

# Executed every time the actor is available.
actions=auto_shot
actions+=/counter_shot,line_cd=30,if=runeforge.sephuzs_proclamation|soulbind.niyas_tools_poison|(conduit.reversal_of_fortune&!runeforge.sephuzs_proclamation)
actions+=/use_items
actions+=/call_action_list,name=cds
actions+=/call_action_list,name=st,if=active_enemies<3
actions+=/call_action_list,name=trickshots,if=active_enemies>2

actions.cds=berserking,if=buff.trueshot.up|target.time_to_die<13
actions.cds+=/blood_fury,if=buff.trueshot.up|target.time_to_die<16
actions.cds+=/ancestral_call,if=buff.trueshot.up|target.time_to_die<16
actions.cds+=/fireblood,if=buff.trueshot.up|target.time_to_die<9
actions.cds+=/lights_judgment,if=buff.trueshot.down
actions.cds+=/bag_of_tricks,if=buff.trueshot.down
actions.cds+=/potion,if=buff.trueshot.up&buff.bloodlust.up|buff.trueshot.up&target.health.pct<20|target.time_to_die<26

actions.st=steady_shot,if=talent.steady_focus&(prev_gcd.1.steady_shot&buff.steady_focus.remains<5|buff.steady_focus.down)
actions.st+=/kill_shot
actions.st+=/double_tap,if=covenant.kyrian&cooldown.resonating_arrow.remains<gcd|!covenant.kyrian&(cooldown.aimed_shot.up|cooldown.rapid_fire.remains>cooldown.aimed_shot.remains)
actions.st+=/flare,if=tar_trap.up&runeforge.soulforge_embers
actions.st+=/tar_trap,if=runeforge.soulforge_embers&tar_trap.remains<gcd&cooldown.flare.remains<gcd
actions.st+=/explosive_shot
actions.st+=/wild_spirits
actions.st+=/flayed_shot
actions.st+=/death_chakram,if=focus+cast_regen<focus.max
actions.st+=/volley,if=buff.precise_shots.down|!talent.chimaera_shot|active_enemies<2
actions.st+=/a_murder_of_crows
actions.st+=/resonating_arrow
actions.st+=/trueshot,if=buff.precise_shots.down|buff.resonating_arrow.up|buff.wild_spirits.up|buff.volley.up&active_enemies>1
actions.st+=/aimed_shot,target_if=min:(dot.serpent_sting.remains<?action.serpent_sting.in_flight_to_target*dot.serpent_sting.duration),if=buff.precise_shots.down|(buff.trueshot.up|full_recharge_time<gcd+cast_time)&(!talent.chimaera_shot|active_enemies<2)|buff.trick_shots.remains>execute_time&active_enemies>1
actions.st+=/rapid_fire,if=focus+cast_regen<focus.max&(buff.trueshot.down|!runeforge.eagletalons_true_focus)&(buff.double_tap.down|talent.streamline)
actions.st+=/chimaera_shot,if=buff.precise_shots.up|focus>cost+action.aimed_shot.cost
actions.st+=/arcane_shot,if=buff.precise_shots.up|focus>cost+action.aimed_shot.cost
actions.st+=/serpent_sting,target_if=min:remains,if=refreshable&target.time_to_die>duration
actions.st+=/barrage,if=active_enemies>1
actions.st+=/rapid_fire,if=focus+cast_regen<focus.max&(buff.double_tap.down|talent.streamline)
actions.st+=/steady_shot

actions.trickshots=steady_shot,if=talent.steady_focus&in_flight&buff.steady_focus.remains<5
actions.trickshots+=/double_tap,if=covenant.kyrian&cooldown.resonating_arrow.remains<gcd|cooldown.rapid_fire.remains<cooldown.aimed_shot.full_recharge_time|!(talent.streamline&runeforge.surging_shots)|!covenant.kyrian
actions.trickshots+=/tar_trap,if=runeforge.soulforge_embers&tar_trap.remains<gcd&cooldown.flare.remains<gcd
actions.trickshots+=/flare,if=tar_trap.up&runeforge.soulforge_embers
actions.trickshots+=/explosive_shot
actions.trickshots+=/wild_spirits
actions.trickshots+=/resonating_arrow
actions.trickshots+=/volley
actions.trickshots+=/barrage
actions.trickshots+=/trueshot
actions.trickshots+=/rapid_fire,if=buff.trick_shots.remains>=execute_time&runeforge.surging_shots&buff.double_tap.down
actions.trickshots+=/aimed_shot,target_if=min:(dot.serpent_sting.remains<?action.serpent_sting.in_flight_to_target*dot.serpent_sting.duration),if=buff.trick_shots.remains>=execute_time&(buff.precise_shots.down|full_recharge_time<cast_time+gcd|buff.trueshot.up)
actions.trickshots+=/death_chakram,if=focus+cast_regen<focus.max
actions.trickshots+=/rapid_fire,if=buff.trick_shots.remains>=execute_time
actions.trickshots+=/multishot,if=buff.trick_shots.down|buff.precise_shots.up&focus>cost+action.aimed_shot.cost&(!talent.chimaera_shot|active_enemies>3)
actions.trickshots+=/chimaera_shot,if=buff.precise_shots.up&focus>cost+action.aimed_shot.cost&active_enemies<4
actions.trickshots+=/kill_shot,if=buff.dead_eye.down
actions.trickshots+=/a_murder_of_crows
actions.trickshots+=/flayed_shot
actions.trickshots+=/serpent_sting,target_if=min:dot.serpent_sting.remains,if=refreshable
actions.trickshots+=/multishot,if=focus>cost+action.aimed_shot.cost
actions.trickshots+=/steady_shot

head=helm_of_insatiable_appetite,id=183001,bonus_id=7188/1485,ilevel=213
neck=nobles_birthstone_pendant,id=183039,bonus_id=7188/1485,ilevel=213
shoulders=boneshatter_pauldrons,id=172327,bonus_id=7013,ilevel=235
back=crest_of_the_legionnaire_general,id=183032,bonus_id=6805,ilevel=220
chest=master_huntsmans_bandolier,id=182988,bonus_id=6805,ilevel=213,enchant=eternal_skirmish
wrists=bangles_of_errant_pride,id=182977,bonus_id=6805,ilevel=213
hands=oathsworn_soldiers_gauntlets,id=182991,bonus_id=6805,ilevel=220
waist=loadbearing_belt,id=183016,bonus_id=6805,ilevel=213
legs=greaves_of_enigmatic_energies,id=183012,bonus_id=6805,ilevel=213
feet=stoneclas_stompers,id=183006,bonus_id=6805,ilevel=213,enchant=15agility
finger1=most_regal_signet_of_sire_denathrius,id=183036,bonus_id=6805,ilevel=220,enchant=16crit
finger2=ritualists_treasured_ring,id=183037,bonus_id=6805,ilevel=213,enchant=16crit
trinket1=dreadfire_vessel,id=184030,bonus_id=6805,ilevel=220,enchant=shadowcore_oil
trinket2=stone_legion_heraldry,id=184027,bonus_id=6805,ilevel=220
main_hand=deadeye_blunderbuss,id=184250,bonus_id=6805,ilevel=220,enchant=sinful_revelation

# Gear Summary
# gear_ilvl=217.27
# gear_agility=789
# gear_stamina=1300
# gear_crit_rating=443
# gear_haste_rating=604
# gear_mastery_rating=504
# gear_versatility_rating=54
# gear_armor=818

no_lego : 10742 dps, 3708 dps to main target

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
10741.9 10741.9 19.3 / 0.180% 1307.0 / 12.2% 1058.5
RPS Out RPS In Primary Resource Waiting APM Active Skill
10.1 9.9 Focus 0.00% 47.4 100.0% 100%
Talents
Night Fae

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
no_lego 10742
Aimed Shot 3676 (4043) 34.2% (37.6%) 47.6 6.30sec 25446 16450 Direct 237.5 (260.4) 3786 7552 4635 22.5% (22.5%)

Stats Details: Aimed Shot

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 47.55 237.49 0.00 0.00 1.5469 0.0000 1100651.34 1572170.38 29.99% 16450.24 16450.24
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 77.47% 183.98 135 242 3786.13 2524 9967 3788.91 3544 4022 696574 994986 29.99%
crit 22.53% 53.51 26 89 7552.03 5048 19934 7557.87 6405 9110 404077 577184 29.99%

Action Details: Aimed Shot

  • id:19434
  • school:physical
  • range:40.0
  • travel_speed:100.0000
  • radius:8.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:12.000
  • cooldown hasted:true
  • base_recharge_multiplier:1.000
  • base_execute_time:2.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:focus
  • base_cost:35.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:19434
  • name:Aimed Shot
  • school:physical
  • tooltip:
  • description:A powerful aimed shot that deals {$s1=0} Physical damage.

Action Priority List

    trickshots
    [J]:47.75
  • if_expr:buff.trick_shots.remains>=execute_time&(buff.precise_shots.down|full_recharge_time<cast_time+gcd|buff.trueshot.up)
  • target_if_expr:(dot.serpent_sting.remains<?action.serpent_sting.in_flight_to_target*dot.serpent_sting.duration)
    Aimed Shot (_double_tap) 367 3.4% 0.0 0.00sec 0 0 Direct 22.9 3888 7804 4772 22.6%

Stats Details: Aimed Shot Double Tap

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 0.00 22.90 0.00 0.00 0.0000 0.0000 109362.40 156213.25 29.99% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 77.40% 17.73 4 31 3887.68 2524 9967 3919.81 2995 5877 68910 98430 29.99%
crit 22.60% 5.18 0 15 7803.57 5048 19934 7822.93 0 18806 40453 57783 29.70%

Action Details: Aimed Shot Double Tap

  • id:19434
  • school:physical
  • range:40.0
  • travel_speed:100.0000
  • radius:8.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:12.000
  • cooldown hasted:true
  • base_recharge_multiplier:1.000
  • base_execute_time:2.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:focus
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:19434
  • name:Aimed Shot
  • school:physical
  • tooltip:
  • description:A powerful aimed shot that deals {$s1=0} Physical damage.
Auto Shot 373 3.5% 112.6 2.67sec 993 438 Direct 112.4 812 1623 995 22.7%

Stats Details: Auto Shot

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 112.64 112.39 0.00 0.00 2.2687 0.0000 111875.71 159803.27 29.99% 437.79 437.79
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 77.34% 86.93 59 113 811.63 774 1019 811.57 794 827 70554 100780 29.99%
crit 22.66% 25.47 9 43 1622.65 1548 2037 1622.63 1560 1722 41322 59024 29.99%

Action Details: Auto Shot

  • id:75
  • school:physical
  • range:40.0
  • travel_speed:60.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00

Spelldata

  • id:75
  • name:Auto Shot
  • school:physical
  • tooltip:Firing at the target.
  • description:Automatically shoots the target until cancelled.
Dreadfire Vessel 139 1.3% 3.7 90.74sec 11154 0 Direct 3.7 9053 18102 11175 23.6%

Stats Details: Dreadfire Vessel

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 3.73 3.72 0.00 0.00 0.0000 0.0000 41608.28 41608.28 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 76.43% 2.84 0 4 9052.54 8937 9474 9024.16 0 9474 25738 25738 0.00%
crit 23.57% 0.88 0 4 18101.69 17875 18947 11345.19 0 18947 15871 15871 0.00%

Action Details: Dreadfire Vessel

  • id:344732
  • school:fire
  • range:50.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:90.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:8212.26
  • base_dd_max:8212.26
  • base_dd_mult:1.00

Spelldata

  • id:344732
  • name:Dreadfire Vessel
  • school:fire
  • tooltip:
  • description:Unleash incendiary flames at your target inflicting {$s1=0} Fire damage.
Eternal Skirmish 40 0.4% 21.8 13.49sec 547 0 Direct 21.8 446 892 547 22.5%

Stats Details: Eternal Skirmish

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 21.82 21.82 0.00 0.00 0.0000 0.0000 11925.64 11925.64 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 77.46% 16.90 5 32 446.08 435 485 446.04 437 460 7539 7539 0.00%
crit 22.54% 4.92 0 12 891.76 871 969 886.45 0 969 4386 4386 0.00%

Action Details: Eternal Skirmish

  • id:323889
  • school:shadow
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:400.00
  • base_dd_max:400.00
  • base_dd_mult:1.00

Spelldata

  • id:323889
  • name:Eternal Skirmish
  • school:shadow
  • tooltip:
  • description:Deals {$s1=400} Shadow damage.
Kill Shot 83 0.8% 4.6 13.24sec 5364 4491 Direct 4.6 4260 9559 5401 21.6%

Stats Details: Kill Shot

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 4.63 4.60 0.00 0.00 1.1944 0.0000 24841.82 35484.05 29.99% 4491.38 4491.38
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 78.43% 3.61 0 6 4259.79 4065 4838 4248.80 0 4838 15362 21943 29.94%
crit 21.57% 0.99 0 4 9558.89 9146 10885 6437.34 0 10885 9480 13541 20.21%

Action Details: Kill Shot

  • id:53351
  • school:physical
  • range:40.0
  • travel_speed:80.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:10.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:focus
  • base_cost:10.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:53351
  • name:Kill Shot
  • school:physical
  • tooltip:
  • description:You attempt to finish off a wounded target, dealing {$s1=0} Physical damage. Only usable on enemies with less than {$s2=20}% health.

Action Priority List

    trickshots
    [M]:4.63
  • if_expr:buff.dead_eye.down
Master Marksman 482 4.5% 304.2 1.01sec 475 0 Periodic 519.9 278 0 278 0.0% 69.3%

Stats Details: Master Marksman

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 304.19 0.00 519.87 519.87 0.0000 2.0000 144401.44 144401.44 0.00% 138.88 0.00
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 100.00% 519.87 373 652 277.78 37 2833 277.99 219 334 144401 144401 0.00%

Action Details: Master Marksman

  • id:269576
  • school:physical
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:false
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:6.00
  • base_tick_time:2.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH

Spelldata

  • id:269576
  • name:Master Marksman
  • school:physical
  • tooltip:Bleeding for $w1 damage every $t1 sec.
  • description:{$@spelldesc260309=Your ranged special attack critical strikes cause the target to bleed for an additional {$s1=15}% of the damage dealt over {$269576d=6 seconds}.}
Multi-Shot 2693 25.1% 81.5 3.67sec 9908 8685 Direct 406.4 1618 3237 1986 22.7%

Stats Details: Multishot

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 81.46 406.38 0.00 0.00 1.1408 0.0000 807083.75 1152838.43 29.99% 8684.95 8684.95
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 77.30% 314.12 234 393 1618.42 953 2194 1618.35 1492 1731 508362 726145 29.99%
crit 22.70% 92.27 53 133 3237.49 1905 4389 3237.66 2850 3482 298721 426693 29.99%

Action Details: Multishot

  • id:257620
  • school:physical
  • range:40.0
  • travel_speed:50.0000
  • radius:10.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:5
  • harmful:true

Resources

  • resource:focus
  • base_cost:20.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:257620
  • name:Multi-Shot
  • school:physical
  • tooltip:
  • description:Fires several missiles, hitting your current target and up to $I enemies within $A1 yards for {$s1=0} Physical damage.

Action Priority List

    trickshots
    [L]:74.06
  • if_expr:buff.trick_shots.down|buff.precise_shots.up&focus>cost+action.aimed_shot.cost&(!talent.chimaera_shot|active_enemies>3)
    trickshots
    [N]:7.40
  • if_expr:focus>cost+action.aimed_shot.cost
Rapid Fire 1096 10.2% 16.4 18.45sec 20048 11412 Periodic 603.7 444 887 544 22.7% 1.6%

Stats Details: Rapid Fire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 16.39 0.00 121.10 603.68 1.7567 0.2037 328519.47 469257.21 29.99% 11412.08 11412.08
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 77.29% 466.61 312 660 443.62 351 925 443.67 431 464 207008 295690 29.99%
crit 22.71% 137.07 82 197 886.55 703 1850 886.58 806 969 121512 173567 29.99%

Action Details: Rapid Fire

  • id:257044
  • school:physical
  • range:40.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:20.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:false
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:2.00
  • base_tick_time:0.33
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH

Spelldata

  • id:257044
  • name:Rapid Fire
  • school:physical
  • tooltip:Being targeted by Rapid Fire.
  • description:Shoot a stream of {$s1=7} shots at your target over {$d=2 seconds}, dealing a total of ${$m1*$257045sw1} Physical damage. {$?s321281=true}[ Each shot generates {$263585s1=1} Focus.][] Usable while moving.

Action Details: Rapid Fire Damage

  • id:257045
  • school:physical
  • range:40.0
  • travel_speed:40.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:on_hit
  • energize_resource:focus
  • energize_amount:1.0

Spelldata

  • id:257045
  • name:Rapid Fire
  • school:physical
  • tooltip:
  • description:{$@spelldesc257044=Shoot a stream of {$s1=7} shots at your target over {$d=2 seconds}, dealing a total of ${$m1*$257045sw1} Physical damage. {$?s321281=true}[ Each shot generates {$263585s1=1} Focus.][] Usable while moving.}

Action Priority List

    trickshots
    [K]:16.39
  • if_expr:buff.trick_shots.remains>=execute_time
Shadowcore Oil Blast 44 0.4% 43.7 6.70sec 301 0 Direct 43.7 245 491 301 22.5%

Stats Details: Shadowcore Oil Blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 43.74 43.74 0.00 0.00 0.0000 0.0000 13149.21 13149.21 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 77.49% 33.89 19 54 245.44 239 266 245.45 241 251 8319 8319 0.00%
crit 22.51% 9.84 2 23 490.73 479 533 490.72 479 520 4830 4830 0.00%

Action Details: Shadowcore Oil Blast

  • id:336463
  • school:shadow
  • range:60.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:220.00
  • base_dd_max:220.00
  • base_dd_mult:1.00

Spelldata

  • id:336463
  • name:Shadowcore Oil Blast
  • school:shadow
  • tooltip:
  • description:Deals {$s1=220} Shadow damage.
Steady Shot 348 3.3% 66.5 4.47sec 1572 1167 Direct 67.4 1266 2532 1552 22.5%

Stats Details: Steady Shot

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 66.52 67.41 0.00 0.00 1.3475 0.0000 104588.55 149394.29 29.99% 1166.75 1166.75
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 77.46% 52.21 35 71 1266.17 1219 1605 1265.89 1234 1292 66110 94432 29.99%
crit 22.54% 15.20 3 31 2532.13 2439 3210 2531.83 2439 2717 38478 54962 29.99%

Action Details: Steady Shot

  • id:56641
  • school:physical
  • range:40.0
  • travel_speed:75.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:1.75
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:on_cast
  • energize_resource:focus
  • energize_amount:10.0

Spelldata

  • id:56641
  • name:Steady Shot
  • school:physical
  • tooltip:
  • description:A steady shot that causes {$s1=0} Physical damage. Usable while moving.{$?s321018=true}[ |cFFFFFFFFGenerates {$s2=0} Focus.][]

Action Priority List

    trickshots
    [F]:16.24
  • if_expr:talent.steady_focus&in_flight&buff.steady_focus.remains<5
    trickshots
    [O]:50.56
Wild Spirits 50 (1401) 0.5% (13.0%) 3.0 120.68sec 140058 127423 Direct 14.8 (233.2) 808 1614 992 22.8% (22.6%)

Stats Details: Wild Spirits

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.98 14.83 0.00 0.00 1.0993 0.0000 14707.65 14707.65 0.00% 127422.89 127422.89
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 77.17% 11.45 5 15 807.53 776 910 807.64 785 838 9243 9243 0.00%
crit 22.83% 3.39 0 9 1613.98 1552 1820 1575.11 0 1751 5465 5465 0.00%

Action Details: Wild Spirits

  • id:328231
  • school:nature
  • range:40.0
  • travel_speed:30.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:120.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:328231
  • name:Wild Spirits
  • school:nature
  • tooltip:
  • description:Evoke the energy of Wild Spirits at the target location, dealing {$328837s3=0} Nature damage and apply Hunter's Mark to all enemy targets within the area for {$328837d=15 seconds}. While the Wild Spirits are active, each damaging ability you or your pet use against a target in the area will strike up to $328757I nearby targets for {$328757s1=0} Nature damage.

Action Details: Wild Spirits Damage

  • id:328837
  • school:nature
  • range:100.0
  • travel_speed:0.0000
  • radius:12.0
  • trigger_gcd:0.0000
  • gcd_type:attack_haste
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:328837
  • name:Wild Spirits
  • school:nature
  • tooltip:
  • description:{$@spelldesc328231=Evoke the energy of Wild Spirits at the target location, dealing {$328837s3=0} Nature damage and apply Hunter's Mark to all enemy targets within the area for {$328837d=15 seconds}. While the Wild Spirits are active, each damaging ability you or your pet use against a target in the area will strike up to $328757I nearby targets for {$328757s1=0} Nature damage.}

Action Priority List

    trickshots
    [H]:2.98
    Wild Spirits (_proc) 1351 12.5% 43.7 5.88sec 9214 0 Direct 218.4 1504 3007 1843 22.6%

Stats Details: Wild Spirits Proc

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 43.68 218.39 0.00 0.00 0.0000 0.0000 402474.89 402474.89 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 77.44% 169.12 114 197 1503.74 1355 1699 1504.40 1486 1544 254324 254324 0.00%
crit 22.56% 49.27 25 73 3006.79 2711 3398 3008.40 2930 3120 148151 148151 0.00%

Action Details: Wild Spirits Proc

  • id:328757
  • school:nature
  • range:40.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:attack_haste
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:5
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:328757
  • name:Wild Spirits
  • school:nature
  • tooltip:
  • description:{$@spelldesc328231=Evoke the energy of Wild Spirits at the target location, dealing {$328837s3=0} Nature damage and apply Hunter's Mark to all enemy targets within the area for {$328837d=15 seconds}. While the Wild Spirits are active, each damaging ability you or your pet use against a target in the area will strike up to $328757I nearby targets for {$328757s1=0} Nature damage.}
Simple Action Stats Execute Interval
no_lego
Veiled Augmentation (augmentation) 1.0 0.00sec

Stats Details: Augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Augmentation

  • id:347901
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:no_lego
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Blood Fury 3.0 120.80sec

Stats Details: Blood Fury

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.97 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Blood Fury

  • id:20572
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:120.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:20572
  • name:Blood Fury
  • school:physical
  • tooltip:Attack power increased by $w1.
  • description:Increases your attack power by {$s1=122} for {$d=15 seconds}.

Action Priority List

    cds
    [D]:2.97
  • if_expr:buff.trueshot.up|target.time_to_die<16
Double Tap 5.6 60.60sec

Stats Details: Double Tap

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 5.60 0.00 0.00 0.00 0.9769 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Double Tap

  • id:260402
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:60.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:260402
  • name:Double Tap
  • school:physical
  • tooltip:Your next Aimed Shot will fire a second time instantly at {$s4=100}% power and consume no Focus, or your next Rapid Fire will shoot {$s3=100}% additional shots during its channel.
  • description:Your next Aimed Shot will fire a second time instantly at {$s4=100}% power without consuming Focus, or your next Rapid Fire will shoot {$s3=100}% additional shots during its channel.

Action Priority List

    trickshots
    [G]:4.60
  • if_expr:covenant.kyrian&cooldown.resonating_arrow.remains<gcd|cooldown.rapid_fire.remains<cooldown.aimed_shot.full_recharge_time|!(talent.streamline&runeforge.surging_shots)|!covenant.kyrian
Spectral Flask of Power (flask) 1.0 0.00sec

Stats Details: Flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Flask

  • id:307185
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:no_lego
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Feast of Gluttonous Hedonism (food) 1.0 0.00sec

Stats Details: Food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Food

  • id:308462
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:no_lego
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Potion of Spectral Agility (potion) 1.5 309.77sec

Stats Details: Potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.48 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Potion

  • id:307159
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:300.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Action Priority List

    cds
    [E]:1.47
  • if_expr:buff.trueshot.up&buff.bloodlust.up|buff.trueshot.up&target.health.pct<20|target.time_to_die<26
Trueshot 3.0 120.82sec

Stats Details: Trueshot

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.97 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Trueshot

  • id:288613
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:attack_haste
  • min_gcd:0.0000
  • cooldown:120.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:288613
  • name:Trueshot
  • school:physical
  • tooltip:The cooldown of Aimed Shot and Rapid Fire is reduced by ${$m1/4}%, and Aimed Shot casts {$s4=50}% faster. All Focus generation is increased by {$s5=50}%.
  • description:Reduces the cooldown of your Aimed Shot and Rapid Fire by ${$m1/4}%, and causes Aimed Shot to cast {$s4=50}% faster for {$d=15 seconds}. While Trueshot is active, you generate {$s5=50}% additional Focus.

Action Priority List

    trickshots
    [I]:2.97

Buffs

Dynamic Buffs Start Refresh Interval Trigger Avg Dur Up-Time Benefit Overflow Expiry
Blood Fury 3.0 0.0 120.8sec 120.8sec 14.7sec 14.63% 0.00% 0.0 (0.0) 2.8

Buff Details

  • buff initial source:no_lego
  • cooldown name:buff_blood_fury
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:120.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:attack_power
  • amount:122.00

Trigger Details

  • interval_min/max:120.0s / 123.0s
  • trigger_min/max:120.0s / 123.0s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 15.0s

Stack Uptimes

  • blood_fury_1:14.63%

Spelldata

  • id:20572
  • name:Blood Fury
  • tooltip:Attack power increased by $w1.
  • description:Increases your attack power by {$s1=122} for {$d=15 seconds}.
  • max_stacks:0
  • duration:15.00
  • cooldown:120.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 40.0sec 13.52% 0.00% 0.0 (0.0) 1.0

Buff Details

  • buff initial source:no_lego
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • base duration:40.00
  • duration modifier:1.00
  • base cooldown:300.00
  • default_chance:100.00%
  • default_value:0.30
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:40.0s / 40.0s

Stack Uptimes

  • bloodlust_1:13.52%

Spelldata

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by $w1%.
  • description:Increases haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Double Tap 5.6 0.0 58.4sec 60.6sec 4.5sec 8.34% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:no_lego
  • cooldown name:buff_double_tap
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.50
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:50.0s / 62.6s
  • trigger_min/max:60.0s / 62.6s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 11.2s

Stack Uptimes

  • double_tap_1:8.34%

Spelldata

  • id:260402
  • name:Double Tap
  • tooltip:Your next Aimed Shot will fire a second time instantly at {$s4=100}% power and consume no Focus, or your next Rapid Fire will shoot {$s3=100}% additional shots during its channel.
  • description:Your next Aimed Shot will fire a second time instantly at {$s4=100}% power without consuming Focus, or your next Rapid Fire will shoot {$s3=100}% additional shots during its channel.
  • max_stacks:0
  • duration:15.00
  • cooldown:60.00
  • default_chance:0.00%
Well Fed (feast_of_gluttonous_hedonism) 1.0 0.0 0.0sec 0.0sec 300.0sec 100.00% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:no_lego
  • cooldown name:buff_feast_of_gluttonous_hedonism
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:agility
  • amount:20.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:240.1s / 359.8s

Stack Uptimes

  • feast_of_gluttonous_hedonism_1:100.00%

Spelldata

  • id:327709
  • name:Well Fed
  • tooltip:Agility increased by $w1.
  • description:Agility increased by {$s1=20}. Lasts {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Lock and Load 8.7 0.2 30.8sec 30.2sec 1.8sec 5.33% 17.91% 0.2 (0.2) 0.0

Buff Details

  • buff initial source:no_lego
  • cooldown name:buff_lock_and_load
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:8.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:1.8s / 241.7s
  • trigger_min/max:1.8s / 241.7s
  • trigger_pct:7.90%
  • duration_min/max:0.0s / 10.1s

Stack Uptimes

  • lock_and_load_1:5.33%

Spelldata

  • id:194594
  • name:Lock and Load
  • tooltip:Aimed Shot costs no Focus and is instant.
  • description:{$@spelldesc194595=Your ranged auto attacks have a {$194595h=8}% chance to trigger Lock and Load, causing your next Aimed Shot to cost no Focus and be instant.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%

Trigger Spelldata

  • id:194595
  • name:Lock and Load
  • tooltip:
  • description:Your ranged auto attacks have a {$194595h=8}% chance to trigger Lock and Load, causing your next Aimed Shot to cost no Focus and be instant.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:8.00%
Potion of Spectral Agility 1.5 0.0 309.3sec 309.3sec 23.3sec 11.25% 0.00% 0.0 (0.0) 1.2

Buff Details

  • buff initial source:no_lego
  • cooldown name:buff_potion_of_spectral_agility
  • max_stacks:1
  • base duration:25.00
  • duration modifier:1.00
  • base cooldown:1.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:agility
  • amount:190.00

Trigger Details

  • interval_min/max:300.0s / 332.4s
  • trigger_min/max:300.0s / 332.4s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 25.0s

Stack Uptimes

  • potion_of_spectral_agility_1:11.25%

Spelldata

  • id:307159
  • name:Potion of Spectral Agility
  • tooltip:Agility increased by $w1.
  • description:Increases your Agility by {$s1=190} for {$d=25 seconds}.
  • max_stacks:0
  • duration:25.00
  • cooldown:1.00
  • default_chance:0.00%
Precise Shots 40.1 7.4 7.4sec 6.3sec 2.9sec 38.61% 82.32% 3.7 (3.7) 0.0

Buff Details

  • buff initial source:no_lego
  • cooldown name:buff_precise_shots
  • max_stacks:2
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.50
  • default_chance:101.00%
  • default_value:0.75
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.9s / 35.3s
  • trigger_min/max:0.9s / 14.1s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 30.4s

Stack Uptimes

  • precise_shots_1:33.25%
  • precise_shots_2:5.36%

Spelldata

  • id:260242
  • name:Precise Shots
  • tooltip:Damage of {$?s342049=false}[Chimaera Shot][Arcane Shot] or Multi-Shot increased by {$s1=75}%.
  • description:{$@spelldesc260240=Aimed Shot causes your next 1-{$260242u=2} {$?s342049=false}[Chimaera Shots][Arcane Shots] or Multi-Shots to deal {$260242s1=75}% more damage.}
  • max_stacks:2
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
Spectral Flask of Power 1.0 0.0 0.0sec 0.0sec 300.0sec 100.00% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:no_lego
  • cooldown name:buff_spectral_flask_of_power
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:agility
  • amount:70.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:240.1s / 359.8s

Stack Uptimes

  • spectral_flask_of_power_1:100.00%

Spelldata

  • id:307185
  • name:Spectral Flask of Power
  • tooltip:$pri increased by $w1.
  • description:Increases $pri by {$s1=70} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Steady Focus 6.1 18.7 52.1sec 12.2sec 46.2sec 94.35% 0.00% 18.7 (18.7) 5.2

Buff Details

  • buff initial source:no_lego
  • cooldown name:buff_steady_focus
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.07
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:15.0s / 283.8s
  • trigger_min/max:4.0s / 40.4s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 283.1s

Stack Uptimes

  • steady_focus_1:94.35%

Spelldata

  • id:193534
  • name:Steady Focus
  • tooltip:Haste increased by {$s1=7}%.
  • description:{$@spelldesc193533=Using Steady Shot twice in a row increases your Haste by {$193534s1=7}% for {$193534d=15 seconds}.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%

Trigger Spelldata

  • id:193533
  • name:Steady Focus
  • tooltip:
  • description:Using Steady Shot twice in a row increases your Haste by {$193534s1=7}% for {$193534d=15 seconds}.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
Trick Shots 64.7 16.7 4.6sec 3.7sec 4.1sec 88.81% 100.00% 16.7 (16.7) 0.0

Buff Details

  • buff initial source:no_lego
  • cooldown name:buff_trick_shots
  • max_stacks:1
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:1.8s / 12.3s
  • trigger_min/max:0.9s / 10.1s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 12.3s

Stack Uptimes

  • trick_shots_1:88.81%

Spelldata

  • id:257622
  • name:Trick Shots
  • tooltip:Your next Aimed Shot or Rapid Fire will ricochet and hit {$257621s1=5} additional targets for {$257621s4=50}% of normal damage.
  • description:{$@spelldesc257621=When Multi-Shot hits {$s2=3} or more targets, your next Aimed Shot or Rapid Fire will ricochet and hit up to {$s1=5} additional targets for {$s4=50}% of normal damage.}
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
Trueshot 3.0 0.0 120.8sec 120.8sec 19.1sec 18.98% 0.00% 0.0 (0.0) 2.8

Buff Details

  • buff initial source:no_lego
  • cooldown name:buff_trueshot
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.31
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.50
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:120.0s / 123.0s
  • trigger_min/max:120.0s / 123.0s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 19.7s

Stack Uptimes

  • trueshot_1:18.98%

Spelldata

  • id:288613
  • name:Trueshot
  • tooltip:The cooldown of Aimed Shot and Rapid Fire is reduced by ${$m1/4}%, and Aimed Shot casts {$s4=50}% faster. All Focus generation is increased by {$s5=50}%.
  • description:Reduces the cooldown of your Aimed Shot and Rapid Fire by ${$m1/4}%, and causes Aimed Shot to cast {$s4=50}% faster for {$d=15 seconds}. While Trueshot is active, you generate {$s5=50}% additional Focus.
  • max_stacks:0
  • duration:15.00
  • cooldown:120.00
  • default_chance:0.00%
Veiled Augmentation 1.0 0.0 0.0sec 0.0sec 300.0sec 100.00% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:no_lego
  • cooldown name:buff_veiled_augmentation
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:agility
  • amount:18.00
  • stat:strength
  • amount:18.00
  • stat:intellect
  • amount:18.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:240.1s / 359.8s

Stack Uptimes

  • veiled_augmentation_1:100.00%

Spelldata

  • id:347901
  • name:Veiled Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=18} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Wild Spirits 3.0 0.0 120.7sec 120.7sec 17.5sec 17.43% 0.00% 0.0 (0.0) 2.8

Buff Details

  • buff initial source:no_lego
  • cooldown name:buff_wild_spirits
  • max_stacks:1
  • base duration:18.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:120.0s / 122.7s
  • trigger_min/max:120.0s / 122.7s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 18.0s

Stack Uptimes

  • wild_spirits_1:17.43%

Spelldata

  • id:328837
  • name:Wild Spirits
  • tooltip:
  • description:{$@spelldesc328231=Evoke the energy of Wild Spirits at the target location, dealing {$328837s3=0} Nature damage and apply Hunter's Mark to all enemy targets within the area for {$328837d=15 seconds}. While the Wild Spirits are active, each damaging ability you or your pet use against a target in the area will strike up to $328757I nearby targets for {$328757s1=0} Nature damage.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
Windfury Totem 1.0 0.0 0.0sec 0.0sec 300.0sec 100.00% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:no_lego
  • cooldown name:buff_windfury_totem
  • max_stacks:1
  • base duration:900.00
  • duration modifier:1.00
  • base cooldown:0.50
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:240.1s / 359.8s

Stack Uptimes

  • windfury_totem_1:100.00%

Spelldata

  • id:327942
  • name:Windfury Totem
  • tooltip:Your auto-attacks have a {$h=10}% chance to instantly attack again.
  • description:{$@spelldesc8512=Summons a Windfury Totem with {$s1=5} health at the feet of the caster for {$d=120 seconds}. Party members within {$s2=30} yds have a {$327942h=10}% chance when they auto-attack to swing an extra time.}
  • max_stacks:0
  • duration:120.00
  • cooldown:0.00
  • default_chance:10.00%
Constant Buffs
Arcane Intellect

Buff Details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff Details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:15.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
Power Word: Fortitude

Buff Details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.$?$w2>0[ Magic damage taken reduced by $w2%.][]
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Procs, Uptimes & Benefits

Proc Count Min Max Interval Min Max
double_tap_aimed 4.6 1.0 7.0 69.4s 47.1s 296.3s
double_tap_rapid_fire 1.0 0.0 4.0 98.8s 54.7s 243.6s
Uptime Avg % Min Max Avg Dur Min Max
Focus Cap 0.87% 0.68% 1.71% 0.9s 0.0s 2.4s

Cooldown waste details

Seconds per ExecuteSeconds per Iteration
AbilityAverageMinimumMaximumAverageMinimumMaximum
Double Tap0.7390.0012.6472.7910.0027.416
Aimed Shot1.2760.0016.87213.3714.39626.547
Kill Shot3.6940.00123.54312.4170.13930.413
Wild Spirits0.7700.0012.6961.2980.0004.106
Trueshot0.8400.0012.9711.5680.2724.378
Rapid Fire3.1130.00125.32041.91620.62773.125

Resources

Gains Type Count Total Tot% Avg Overflow Ovr%
no_lego
steady_shot Focus 67.52 655.15 22.03% 9.70 20.03 2.97%
rapid_fire Focus 121.12 120.91 4.07% 1.00 0.21 0.17%
focus_regen Focus 609.39 1945.23 65.42% 3.19 19.16 0.98%
Trueshot Focus 191.43 252.15 8.48% 1.32 0.88 0.35%
Change Start Gain/s Loss/s Overflow (Total) End (Avg) Min Max
Focus 100.0 9.91 10.13 40.3 35.9 0.5 100.0
Usage Type Count Total Avg RPE APR
no_lego
aimed_shot Focus 47.6 1361.9 28.6 28.6 888.5
kill_shot Focus 4.6 46.3 10.0 10.0 536.6
multishot Focus 81.5 1629.2 20.0 20.0 495.4

Statistics & Data Analysis

Fight Length
no_lego Fight Length
Count 1217
Mean 299.97
Minimum 240.10
Maximum 359.83
Spread ( max - min ) 119.74
Range [ ( max - min ) / 2 * 100% ] 19.96%
DPS
no_lego Damage Per Second
Count 1217
Mean 10741.89
Minimum 9699.02
Maximum 11940.48
Spread ( max - min ) 2241.46
Range [ ( max - min ) / 2 * 100% ] 10.43%
Standard Deviation 343.3390
5th Percentile 10202.94
95th Percentile 11316.50
( 95th Percentile - 5th Percentile ) 1113.56
Mean Distribution
Standard Deviation 9.8419
95.00% Confidence Interval ( 10722.60 - 10761.18 )
Normalized 95.00% Confidence Interval ( 99.82% - 100.18% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 40
0.1% Error 3925
0.1 Scale Factor Error with Delta=300 1007
0.05 Scale Factor Error with Delta=300 4026
0.01 Scale Factor Error with Delta=300 100631
Priority Target DPS
no_lego Priority Target Damage Per Second
Count 1217
Mean 3707.84
Minimum 3297.93
Maximum 4145.31
Spread ( max - min ) 847.37
Range [ ( max - min ) / 2 * 100% ] 11.43%
Standard Deviation 132.2594
5th Percentile 3495.97
95th Percentile 3936.91
( 95th Percentile - 5th Percentile ) 440.94
Mean Distribution
Standard Deviation 3.7912
95.00% Confidence Interval ( 3700.41 - 3715.27 )
Normalized 95.00% Confidence Interval ( 99.80% - 100.20% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 49
0.1% Error 4888
0.1 Scale Factor Error with Delta=300 150
0.05 Scale Factor Error with Delta=300 598
0.01 Scale Factor Error with Delta=300 14933
DPS(e)
no_lego Damage Per Second (Effective)
Count 1217
Mean 10741.89
Minimum 9699.02
Maximum 11940.48
Spread ( max - min ) 2241.46
Range [ ( max - min ) / 2 * 100% ] 10.43%
Damage
no_lego Damage
Count 1217
Mean 3215190.15
Minimum 2468631.56
Maximum 3935516.48
Spread ( max - min ) 1466884.92
Range [ ( max - min ) / 2 * 100% ] 22.81%
DTPS
no_lego Damage Taken Per Second
Count 1217
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
no_lego Healing Per Second
Count 1217
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
no_lego Healing Per Second (Effective)
Count 1217
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
no_lego Heal
Count 1217
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
no_lego Healing Taken Per Second
Count 1217
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
no_lego Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
no_legoTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
no_lego Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask
1 0.00 augmentation
2 0.00 food
3 0.00 snapshot_stats
Snapshot raid buffed stats before combat begins and pre-potting is done.
4 0.00 tar_trap,if=runeforge.soulforge_embers
5 0.00 double_tap,precast_time=10,if=!covenant.kyrian&(!talent.volley|active_enemies<2)
6 0.00 aimed_shot,if=active_enemies<3
7 0.00 steady_shot,if=active_enemies>2
Default action list Executed every time the actor is available.
# count action,conditions
8 1.00 auto_shot
0.00 counter_shot,line_cd=30,if=runeforge.sephuzs_proclamation|soulbind.niyas_tools_poison|(conduit.reversal_of_fortune&!runeforge.sephuzs_proclamation)
9 3.73 use_items
A 0.00 call_action_list,name=cds
B 0.00 call_action_list,name=st,if=active_enemies<3
C 0.00 call_action_list,name=trickshots,if=active_enemies>2
actions.cds
# count action,conditions
0.00 berserking,if=buff.trueshot.up|target.time_to_die<13
D 2.97 blood_fury,if=buff.trueshot.up|target.time_to_die<16
0.00 ancestral_call,if=buff.trueshot.up|target.time_to_die<16
0.00 fireblood,if=buff.trueshot.up|target.time_to_die<9
0.00 lights_judgment,if=buff.trueshot.down
0.00 bag_of_tricks,if=buff.trueshot.down
E 1.47 potion,if=buff.trueshot.up&buff.bloodlust.up|buff.trueshot.up&target.health.pct<20|target.time_to_die<26
actions.trickshots
# count action,conditions
F 16.24 steady_shot,if=talent.steady_focus&in_flight&buff.steady_focus.remains<5
G 4.60 double_tap,if=covenant.kyrian&cooldown.resonating_arrow.remains<gcd|cooldown.rapid_fire.remains<cooldown.aimed_shot.full_recharge_time|!(talent.streamline&runeforge.surging_shots)|!covenant.kyrian
0.00 tar_trap,if=runeforge.soulforge_embers&tar_trap.remains<gcd&cooldown.flare.remains<gcd
0.00 flare,if=tar_trap.up&runeforge.soulforge_embers
0.00 explosive_shot
H 2.98 wild_spirits
0.00 resonating_arrow
0.00 volley
0.00 barrage
I 2.97 trueshot
0.00 rapid_fire,if=buff.trick_shots.remains>=execute_time&runeforge.surging_shots&buff.double_tap.down
J 47.75 aimed_shot,target_if=min:(dot.serpent_sting.remains<?action.serpent_sting.in_flight_to_target*dot.serpent_sting.duration),if=buff.trick_shots.remains>=execute_time&(buff.precise_shots.down|full_recharge_time<cast_time+gcd|buff.trueshot.up)
0.00 death_chakram,if=focus+cast_regen<focus.max
K 16.39 rapid_fire,if=buff.trick_shots.remains>=execute_time
L 74.06 multishot,if=buff.trick_shots.down|buff.precise_shots.up&focus>cost+action.aimed_shot.cost&(!talent.chimaera_shot|active_enemies>3)
0.00 chimaera_shot,if=buff.precise_shots.up&focus>cost+action.aimed_shot.cost&active_enemies<4
M 4.63 kill_shot,if=buff.dead_eye.down
0.00 a_murder_of_crows
0.00 flayed_shot
0.00 serpent_sting,target_if=min:dot.serpent_sting.remains,if=refreshable
N 7.40 multishot,if=focus>cost+action.aimed_shot.cost
O 50.56 steady_shot

Sample Sequence

0125789FHIDELJLJLJLKLJLOFJLJOLKLJLOFLJLOOJLKLOJOLLJOFLJLGJLKLOFJLOONJLOOOKLJLOLOFJL9ONJLOJLKLOFJLOLGONJLOFKHIDLJLJLKLOFJLJLKLJOFLOLJLKLJLOFOJLJLOOGJLKLJ9LOFOLJLOONJLJOLKLOFJLOOLJLJLOKLJLJOFGLOJLJLOFHIDJLJOLJOLKLJLOFJLKLJL9OOJLOOOLJLKLMOFGJLOOMJLOKLNMJLOFLJLMOOLEJLKLJLMOFJLOOMJLKL

Sample Sequence Table

Time List # Name Target Resources Buffs
Pre precombat 0 flask no_lego 100.0/100: 100% focus
Pre precombat 1 augmentation no_lego 100.0/100: 100% focus
Pre precombat 2 food no_lego 100.0/100: 100% focus
Pre precombat 5 double_tap Fluffy_Pillow 100.0/100: 100% focus
Pre precombat 7 steady_shot Fluffy_Pillow 100.0/100: 100% focus double_tap
0:00.000 default 8 auto_attack Fluffy_Pillow 100.0/100: 100% focus double_tap
0:00.000 default 9 use_items Fluffy_Pillow 100.0/100: 100% focus double_tap
0:00.000 trickshots F steady_shot Fluffy_Pillow 100.0/100: 100% focus double_tap
0:01.485 trickshots H wild_spirits Fluffy_Pillow 100.0/100: 100% focus bloodlust, double_tap, steady_focus
0:02.401 trickshots I trueshot Fluffy_Pillow 100.0/100: 100% focus bloodlust, double_tap, steady_focus
0:02.401 cds D blood_fury Fluffy_Pillow 100.0/100: 100% focus bloodlust, double_tap, steady_focus, trueshot
0:02.401 cds E potion Fluffy_Pillow 100.0/100: 100% focus bloodlust, blood_fury, double_tap, steady_focus, trueshot
0:02.401 trickshots L multishot Fluffy_Pillow 100.0/100: 100% focus bloodlust, blood_fury, double_tap, steady_focus, trueshot, potion_of_spectral_agility
0:03.317 trickshots J aimed_shot Fluffy_Pillow 91.3/100: 91% focus bloodlust, blood_fury, double_tap, steady_focus, trick_shots, trueshot, wild_spirits, potion_of_spectral_agility
0:04.233 trickshots L multishot Fluffy_Pillow 66.9/100: 67% focus bloodlust, blood_fury, precise_shots, steady_focus, trueshot, wild_spirits, potion_of_spectral_agility
0:05.147 trickshots J aimed_shot Fluffy_Pillow 58.2/100: 58% focus bloodlust, blood_fury, steady_focus, trick_shots, trueshot, wild_spirits, potion_of_spectral_agility
0:06.062 trickshots L multishot Fluffy_Pillow 34.5/100: 35% focus bloodlust, blood_fury, precise_shots, steady_focus, trueshot, wild_spirits, potion_of_spectral_agility
0:06.977 trickshots J aimed_shot Fluffy_Pillow 25.8/100: 26% focus bloodlust, blood_fury, lock_and_load, steady_focus, trick_shots, trueshot, wild_spirits, potion_of_spectral_agility
0:07.892 trickshots L multishot Fluffy_Pillow 37.1/100: 37% focus bloodlust, blood_fury, precise_shots(2), steady_focus, trueshot, wild_spirits, potion_of_spectral_agility
0:08.806 trickshots K rapid_fire Fluffy_Pillow 28.4/100: 28% focus bloodlust, blood_fury, precise_shots, steady_focus, trick_shots, trueshot, wild_spirits, potion_of_spectral_agility
0:10.266 trickshots L multishot Fluffy_Pillow 56.4/100: 56% focus bloodlust, blood_fury, precise_shots, steady_focus, trueshot, wild_spirits, potion_of_spectral_agility
0:11.180 trickshots J aimed_shot Fluffy_Pillow 47.7/100: 48% focus bloodlust, blood_fury, steady_focus, trick_shots, trueshot, wild_spirits, potion_of_spectral_agility
0:12.096 trickshots L multishot Fluffy_Pillow 24.0/100: 24% focus bloodlust, blood_fury, precise_shots, steady_focus, trueshot, wild_spirits, potion_of_spectral_agility
0:13.012 trickshots O steady_shot Fluffy_Pillow 15.3/100: 15% focus bloodlust, blood_fury, steady_focus, trick_shots, trueshot, wild_spirits, potion_of_spectral_agility
0:14.080 trickshots F steady_shot Fluffy_Pillow 43.5/100: 43% focus bloodlust, blood_fury, steady_focus, trick_shots, trueshot, wild_spirits, potion_of_spectral_agility
0:15.146 trickshots J aimed_shot Fluffy_Pillow 71.6/100: 72% focus bloodlust, blood_fury, steady_focus, trick_shots, trueshot, wild_spirits, potion_of_spectral_agility
0:16.060 trickshots L multishot Fluffy_Pillow 47.9/100: 48% focus bloodlust, blood_fury, precise_shots, steady_focus, trueshot, wild_spirits, potion_of_spectral_agility
0:16.975 trickshots J aimed_shot Fluffy_Pillow 39.2/100: 39% focus bloodlust, blood_fury, steady_focus, trick_shots, trueshot, wild_spirits, potion_of_spectral_agility
0:17.891 trickshots O steady_shot Fluffy_Pillow 15.5/100: 16% focus bloodlust, precise_shots, steady_focus, trueshot, wild_spirits, potion_of_spectral_agility
0:18.959 trickshots L multishot Fluffy_Pillow 43.7/100: 44% focus bloodlust, precise_shots, steady_focus, trueshot, wild_spirits, potion_of_spectral_agility
0:19.874 trickshots K rapid_fire Fluffy_Pillow 35.0/100: 35% focus bloodlust, steady_focus, trick_shots, trueshot, wild_spirits, potion_of_spectral_agility
0:21.294 trickshots L multishot Fluffy_Pillow 63.5/100: 64% focus bloodlust, steady_focus, trueshot, potion_of_spectral_agility
0:22.211 trickshots J aimed_shot Fluffy_Pillow 54.2/100: 54% focus bloodlust, steady_focus, trick_shots, potion_of_spectral_agility
0:23.733 trickshots L multishot Fluffy_Pillow 31.7/100: 32% focus bloodlust, precise_shots(2), steady_focus, potion_of_spectral_agility
0:24.648 trickshots O steady_shot Fluffy_Pillow 19.2/100: 19% focus bloodlust, precise_shots, steady_focus, trick_shots, potion_of_spectral_agility
0:25.716 trickshots F steady_shot Fluffy_Pillow 38.0/100: 38% focus bloodlust, precise_shots, steady_focus, trick_shots, potion_of_spectral_agility
0:26.784 trickshots L multishot Fluffy_Pillow 56.8/100: 57% focus bloodlust, precise_shots, steady_focus, trick_shots, potion_of_spectral_agility
0:27.700 trickshots J aimed_shot Fluffy_Pillow 44.3/100: 44% focus bloodlust, steady_focus, trick_shots
0:29.223 trickshots L multishot Fluffy_Pillow 21.9/100: 22% focus bloodlust, precise_shots, steady_focus
0:30.140 trickshots O steady_shot Fluffy_Pillow 9.4/100: 9% focus bloodlust, steady_focus, trick_shots
0:31.206 trickshots O steady_shot Fluffy_Pillow 28.2/100: 28% focus bloodlust, steady_focus, trick_shots
0:32.273 trickshots J aimed_shot Fluffy_Pillow 47.0/100: 47% focus bloodlust, steady_focus, trick_shots
0:33.798 trickshots L multishot Fluffy_Pillow 24.5/100: 25% focus bloodlust, precise_shots, steady_focus
0:34.714 trickshots K rapid_fire Fluffy_Pillow 12.0/100: 12% focus bloodlust, steady_focus, trick_shots
0:36.126 trickshots L multishot Fluffy_Pillow 30.7/100: 31% focus bloodlust, steady_focus
0:37.043 trickshots O steady_shot Fluffy_Pillow 18.2/100: 18% focus bloodlust, steady_focus, trick_shots
0:38.109 trickshots J aimed_shot Fluffy_Pillow 37.0/100: 37% focus bloodlust, steady_focus, trick_shots
0:39.838 trickshots O steady_shot Fluffy_Pillow 16.2/100: 16% focus bloodlust, precise_shots(2), steady_focus
0:40.906 trickshots L multishot Fluffy_Pillow 35.0/100: 35% focus bloodlust, lock_and_load, precise_shots(2), steady_focus
0:41.823 trickshots L multishot Fluffy_Pillow 21.0/100: 21% focus lock_and_load, precise_shots, steady_focus, trick_shots
0:43.012 trickshots J aimed_shot Fluffy_Pillow 8.5/100: 8% focus lock_and_load, steady_focus, trick_shots
0:44.201 trickshots O steady_shot Fluffy_Pillow 16.0/100: 16% focus precise_shots, steady_focus
0:45.586 trickshots F steady_shot Fluffy_Pillow 34.8/100: 35% focus precise_shots, steady_focus
0:46.972 trickshots L multishot Fluffy_Pillow 53.6/100: 54% focus lock_and_load, precise_shots, steady_focus
0:48.161 trickshots J aimed_shot Fluffy_Pillow 41.1/100: 41% focus lock_and_load, steady_focus, trick_shots
0:49.352 trickshots L multishot Fluffy_Pillow 48.6/100: 49% focus precise_shots, steady_focus
0:50.539 trickshots G double_tap Fluffy_Pillow 36.1/100: 36% focus steady_focus, trick_shots
0:51.727 trickshots J aimed_shot Fluffy_Pillow 43.7/100: 44% focus double_tap, steady_focus, trick_shots
0:53.705 trickshots L multishot Fluffy_Pillow 21.2/100: 21% focus precise_shots(2), steady_focus
0:54.895 trickshots K rapid_fire Fluffy_Pillow 8.7/100: 9% focus precise_shots, steady_focus, trick_shots
0:56.944 trickshots L multishot Fluffy_Pillow 28.7/100: 29% focus precise_shots, steady_focus
0:58.131 trickshots O steady_shot Fluffy_Pillow 16.2/100: 16% focus steady_focus, trick_shots
0:59.516 trickshots F steady_shot Fluffy_Pillow 35.0/100: 35% focus steady_focus, trick_shots
1:00.903 trickshots J aimed_shot Fluffy_Pillow 53.7/100: 54% focus steady_focus, trick_shots
1:02.882 trickshots L multishot Fluffy_Pillow 31.3/100: 31% focus precise_shots, steady_focus
1:04.069 trickshots O steady_shot Fluffy_Pillow 18.8/100: 19% focus steady_focus, trick_shots
1:05.456 trickshots O steady_shot Fluffy_Pillow 37.5/100: 38% focus steady_focus, trick_shots
1:06.842 trickshots N multishot Fluffy_Pillow 56.3/100: 56% focus steady_focus, trick_shots
1:08.032 trickshots J aimed_shot Fluffy_Pillow 43.8/100: 44% focus steady_focus, trick_shots
1:10.011 trickshots L multishot Fluffy_Pillow 21.4/100: 21% focus precise_shots(2), steady_focus
1:11.199 trickshots O steady_shot Fluffy_Pillow 8.9/100: 9% focus precise_shots, steady_focus, trick_shots
1:12.586 trickshots O steady_shot Fluffy_Pillow 27.7/100: 28% focus precise_shots, steady_focus, trick_shots
1:13.971 trickshots O steady_shot Fluffy_Pillow 46.4/100: 46% focus precise_shots, steady_focus, trick_shots
1:15.360 trickshots K rapid_fire Fluffy_Pillow 65.2/100: 65% focus precise_shots, steady_focus, trick_shots
1:17.222 trickshots L multishot Fluffy_Pillow 84.0/100: 84% focus precise_shots, steady_focus
1:18.409 trickshots J aimed_shot Fluffy_Pillow 71.5/100: 72% focus steady_focus, trick_shots
1:20.388 trickshots L multishot Fluffy_Pillow 49.1/100: 49% focus precise_shots(2), steady_focus
1:21.577 trickshots O steady_shot Fluffy_Pillow 36.6/100: 37% focus precise_shots, steady_focus, trick_shots
1:22.962 trickshots L multishot Fluffy_Pillow 55.3/100: 55% focus precise_shots, steady_focus, trick_shots
1:24.151 trickshots O steady_shot Fluffy_Pillow 42.9/100: 43% focus steady_focus, trick_shots
1:25.538 trickshots F steady_shot Fluffy_Pillow 61.6/100: 62% focus steady_focus, trick_shots
1:26.924 trickshots J aimed_shot Fluffy_Pillow 80.4/100: 80% focus steady_focus, trick_shots
1:28.902 trickshots L multishot Fluffy_Pillow 57.9/100: 58% focus precise_shots, steady_focus
1:30.091 default 9 use_items Fluffy_Pillow 45.5/100: 45% focus steady_focus, trick_shots
1:30.091 trickshots O steady_shot Fluffy_Pillow 45.5/100: 45% focus steady_focus, trick_shots
1:31.478 trickshots N multishot Fluffy_Pillow 64.2/100: 64% focus steady_focus, trick_shots
1:32.667 trickshots J aimed_shot Fluffy_Pillow 51.8/100: 52% focus lock_and_load, steady_focus, trick_shots
1:33.855 trickshots L multishot Fluffy_Pillow 59.3/100: 59% focus precise_shots, steady_focus
1:35.044 trickshots O steady_shot Fluffy_Pillow 46.8/100: 47% focus steady_focus, trick_shots
1:36.430 trickshots J aimed_shot Fluffy_Pillow 65.6/100: 66% focus steady_focus, trick_shots
1:38.410 trickshots L multishot Fluffy_Pillow 43.1/100: 43% focus precise_shots, steady_focus
1:39.600 trickshots K rapid_fire Fluffy_Pillow 30.7/100: 31% focus steady_focus, trick_shots
1:41.432 trickshots L multishot Fluffy_Pillow 49.2/100: 49% focus steady_focus
1:42.620 trickshots O steady_shot Fluffy_Pillow 36.5/100: 36% focus trick_shots
1:44.105 trickshots F steady_shot Fluffy_Pillow 55.3/100: 55% focus trick_shots
1:45.590 trickshots J aimed_shot Fluffy_Pillow 74.0/100: 74% focus steady_focus, trick_shots
1:47.568 trickshots L multishot Fluffy_Pillow 51.6/100: 52% focus precise_shots(2), steady_focus
1:48.757 trickshots O steady_shot Fluffy_Pillow 39.1/100: 39% focus precise_shots, steady_focus, trick_shots
1:50.147 trickshots L multishot Fluffy_Pillow 57.9/100: 58% focus precise_shots, steady_focus, trick_shots
1:51.336 trickshots G double_tap Fluffy_Pillow 45.4/100: 45% focus steady_focus, trick_shots
1:52.525 trickshots O steady_shot Fluffy_Pillow 52.9/100: 53% focus double_tap, steady_focus, trick_shots
1:53.912 trickshots N multishot Fluffy_Pillow 71.7/100: 72% focus double_tap, steady_focus, trick_shots
1:55.102 trickshots J aimed_shot Fluffy_Pillow 59.2/100: 59% focus double_tap, steady_focus, trick_shots
1:57.081 trickshots L multishot Fluffy_Pillow 36.8/100: 37% focus precise_shots, steady_focus
1:58.269 trickshots O steady_shot Fluffy_Pillow 24.3/100: 24% focus steady_focus, trick_shots
1:59.655 trickshots F steady_shot Fluffy_Pillow 43.1/100: 43% focus steady_focus, trick_shots
2:01.043 trickshots K rapid_fire Fluffy_Pillow 61.7/100: 62% focus steady_focus, trick_shots
2:02.903 trickshots H wild_spirits Fluffy_Pillow 80.4/100: 80% focus steady_focus
2:04.091 trickshots I trueshot Fluffy_Pillow 88.0/100: 88% focus steady_focus
2:04.091 cds D blood_fury Fluffy_Pillow 88.0/100: 88% focus steady_focus, trueshot
2:04.091 trickshots L multishot Fluffy_Pillow 88.0/100: 88% focus blood_fury, steady_focus, trueshot
2:05.279 trickshots J aimed_shot Fluffy_Pillow 79.2/100: 79% focus blood_fury, steady_focus, trick_shots, trueshot, wild_spirits
2:06.467 trickshots L multishot Fluffy_Pillow 55.5/100: 56% focus blood_fury, precise_shots, steady_focus, trueshot, wild_spirits
2:07.655 trickshots J aimed_shot Fluffy_Pillow 46.8/100: 47% focus blood_fury, steady_focus, trick_shots, trueshot, wild_spirits
2:08.845 trickshots L multishot Fluffy_Pillow 23.1/100: 23% focus blood_fury, precise_shots(2), steady_focus, trueshot, wild_spirits
2:10.035 trickshots K rapid_fire Fluffy_Pillow 14.4/100: 14% focus blood_fury, precise_shots, steady_focus, trick_shots, trueshot, wild_spirits
2:11.779 trickshots L multishot Fluffy_Pillow 38.9/100: 39% focus blood_fury, precise_shots, steady_focus, trueshot, wild_spirits
2:12.970 trickshots O steady_shot Fluffy_Pillow 30.3/100: 30% focus blood_fury, steady_focus, trick_shots, trueshot, wild_spirits
2:14.355 trickshots F steady_shot Fluffy_Pillow 58.4/100: 58% focus blood_fury, steady_focus, trick_shots, trueshot, wild_spirits
2:15.743 trickshots J aimed_shot Fluffy_Pillow 86.6/100: 87% focus blood_fury, steady_focus, trick_shots, trueshot, wild_spirits
2:16.932 trickshots L multishot Fluffy_Pillow 62.9/100: 63% focus blood_fury, precise_shots, steady_focus, trueshot, wild_spirits
2:18.120 trickshots J aimed_shot Fluffy_Pillow 54.1/100: 54% focus blood_fury, steady_focus, trick_shots, trueshot, wild_spirits
2:19.309 trickshots L multishot Fluffy_Pillow 30.4/100: 30% focus precise_shots(2), steady_focus, trueshot, wild_spirits
2:20.497 trickshots K rapid_fire Fluffy_Pillow 21.7/100: 22% focus precise_shots, steady_focus, trick_shots, trueshot, wild_spirits
2:22.226 trickshots L multishot Fluffy_Pillow 50.1/100: 50% focus precise_shots, steady_focus, trueshot, wild_spirits
2:23.415 trickshots J aimed_shot Fluffy_Pillow 41.4/100: 41% focus steady_focus, trick_shots, trueshot
2:24.604 trickshots O steady_shot Fluffy_Pillow 15.0/100: 15% focus precise_shots(2), steady_focus
2:25.992 trickshots F steady_shot Fluffy_Pillow 33.8/100: 34% focus precise_shots(2), steady_focus
2:27.379 trickshots L multishot Fluffy_Pillow 52.5/100: 53% focus precise_shots(2), steady_focus
2:28.568 trickshots O steady_shot Fluffy_Pillow 40.1/100: 40% focus precise_shots, steady_focus, trick_shots
2:29.954 trickshots L multishot Fluffy_Pillow 58.8/100: 59% focus precise_shots, steady_focus, trick_shots
2:31.143 trickshots J aimed_shot Fluffy_Pillow 46.4/100: 46% focus steady_focus, trick_shots
2:33.122 trickshots L multishot Fluffy_Pillow 23.9/100: 24% focus precise_shots(2), steady_focus
2:34.311 trickshots K rapid_fire Fluffy_Pillow 11.4/100: 11% focus precise_shots, steady_focus, trick_shots
2:36.076 trickshots L multishot Fluffy_Pillow 29.6/100: 30% focus lock_and_load, precise_shots, steady_focus
2:37.265 trickshots J aimed_shot Fluffy_Pillow 17.1/100: 17% focus lock_and_load, steady_focus, trick_shots
2:38.453 trickshots L multishot Fluffy_Pillow 24.6/100: 25% focus precise_shots(2), steady_focus
2:39.640 trickshots O steady_shot Fluffy_Pillow 12.1/100: 12% focus precise_shots, steady_focus, trick_shots
2:41.026 trickshots F steady_shot Fluffy_Pillow 30.9/100: 31% focus precise_shots, steady_focus, trick_shots
2:42.413 trickshots O steady_shot Fluffy_Pillow 49.7/100: 50% focus precise_shots, steady_focus, trick_shots
2:43.800 trickshots J aimed_shot Fluffy_Pillow 68.5/100: 68% focus precise_shots, steady_focus, trick_shots
2:45.779 trickshots L multishot Fluffy_Pillow 46.0/100: 46% focus precise_shots(2), steady_focus
2:46.969 trickshots J aimed_shot Fluffy_Pillow 33.5/100: 34% focus lock_and_load, precise_shots, steady_focus, trick_shots
2:48.157 trickshots L multishot Fluffy_Pillow 41.0/100: 41% focus precise_shots(2), steady_focus
2:49.346 trickshots O steady_shot Fluffy_Pillow 28.6/100: 29% focus precise_shots, steady_focus, trick_shots
2:50.733 trickshots O steady_shot Fluffy_Pillow 47.3/100: 47% focus precise_shots, steady_focus, trick_shots
2:52.118 trickshots G double_tap Fluffy_Pillow 66.1/100: 66% focus precise_shots, steady_focus, trick_shots
2:53.307 trickshots J aimed_shot Fluffy_Pillow 73.6/100: 74% focus double_tap, precise_shots, steady_focus, trick_shots
2:55.286 trickshots L multishot Fluffy_Pillow 51.1/100: 51% focus precise_shots(2), steady_focus
2:56.475 trickshots K rapid_fire Fluffy_Pillow 38.7/100: 39% focus precise_shots, steady_focus, trick_shots
2:58.400 trickshots L multishot Fluffy_Pillow 57.9/100: 58% focus precise_shots, steady_focus
2:59.587 trickshots J aimed_shot Fluffy_Pillow 45.4/100: 45% focus steady_focus, trick_shots
3:01.564 default 9 use_items Fluffy_Pillow 22.9/100: 23% focus precise_shots(2), steady_focus
3:01.564 trickshots L multishot Fluffy_Pillow 22.9/100: 23% focus precise_shots(2), steady_focus
3:02.752 trickshots O steady_shot Fluffy_Pillow 10.4/100: 10% focus precise_shots, steady_focus, trick_shots
3:04.136 trickshots F steady_shot Fluffy_Pillow 29.2/100: 29% focus precise_shots, steady_focus, trick_shots
3:05.523 trickshots O steady_shot Fluffy_Pillow 47.9/100: 48% focus precise_shots, steady_focus, trick_shots
3:06.910 trickshots L multishot Fluffy_Pillow 66.7/100: 67% focus precise_shots, steady_focus, trick_shots
3:08.098 trickshots J aimed_shot Fluffy_Pillow 54.2/100: 54% focus steady_focus, trick_shots
3:10.075 trickshots L multishot Fluffy_Pillow 31.8/100: 32% focus precise_shots, steady_focus
3:11.264 trickshots O steady_shot Fluffy_Pillow 19.3/100: 19% focus steady_focus, trick_shots
3:12.652 trickshots O steady_shot Fluffy_Pillow 38.1/100: 38% focus steady_focus, trick_shots
3:14.039 trickshots N multishot Fluffy_Pillow 56.8/100: 57% focus steady_focus, trick_shots
3:15.227 trickshots J aimed_shot Fluffy_Pillow 44.4/100: 44% focus steady_focus, trick_shots
3:16.473 trickshots L multishot Fluffy_Pillow 52.2/100: 52% focus precise_shots, steady_focus
3:17.663 trickshots J aimed_shot Fluffy_Pillow 39.8/100: 40% focus steady_focus, trick_shots
3:19.643 trickshots O steady_shot Fluffy_Pillow 17.3/100: 17% focus precise_shots, steady_focus
3:21.030 trickshots L multishot Fluffy_Pillow 36.1/100: 36% focus precise_shots, steady_focus
3:22.217 trickshots K rapid_fire Fluffy_Pillow 23.6/100: 24% focus steady_focus, trick_shots
3:23.962 trickshots L multishot Fluffy_Pillow 41.6/100: 42% focus steady_focus
3:25.150 trickshots O steady_shot Fluffy_Pillow 29.2/100: 29% focus steady_focus, trick_shots
3:26.536 trickshots F steady_shot Fluffy_Pillow 47.9/100: 48% focus steady_focus, trick_shots
3:27.922 trickshots J aimed_shot Fluffy_Pillow 66.7/100: 67% focus steady_focus, trick_shots
3:29.901 trickshots L multishot Fluffy_Pillow 44.2/100: 44% focus precise_shots(2), steady_focus
3:31.088 trickshots O steady_shot Fluffy_Pillow 31.7/100: 32% focus precise_shots, steady_focus, trick_shots
3:32.474 trickshots O steady_shot Fluffy_Pillow 50.5/100: 51% focus precise_shots, steady_focus, trick_shots
3:33.860 trickshots L multishot Fluffy_Pillow 69.3/100: 69% focus precise_shots, steady_focus, trick_shots
3:35.047 trickshots J aimed_shot Fluffy_Pillow 56.8/100: 57% focus steady_focus, trick_shots
3:37.024 trickshots L multishot Fluffy_Pillow 34.3/100: 34% focus lock_and_load, precise_shots, steady_focus
3:38.213 trickshots J aimed_shot Fluffy_Pillow 21.8/100: 22% focus lock_and_load, steady_focus, trick_shots
3:39.401 trickshots L multishot Fluffy_Pillow 29.4/100: 29% focus precise_shots(2), steady_focus
3:40.589 trickshots O steady_shot Fluffy_Pillow 16.9/100: 17% focus precise_shots, steady_focus, trick_shots
3:41.976 trickshots K rapid_fire Fluffy_Pillow 35.7/100: 36% focus lock_and_load, precise_shots, steady_focus, trick_shots
3:44.022 trickshots L multishot Fluffy_Pillow 55.6/100: 56% focus lock_and_load, precise_shots, steady_focus
3:45.211 trickshots J aimed_shot Fluffy_Pillow 43.1/100: 43% focus lock_and_load, steady_focus, trick_shots
3:46.400 trickshots L multishot Fluffy_Pillow 50.7/100: 51% focus precise_shots, steady_focus
3:47.590 trickshots J aimed_shot Fluffy_Pillow 38.2/100: 38% focus steady_focus, trick_shots
3:49.569 trickshots O steady_shot Fluffy_Pillow 15.4/100: 15% focus precise_shots
3:51.052 trickshots F steady_shot Fluffy_Pillow 34.2/100: 34% focus precise_shots
3:52.535 trickshots G double_tap Fluffy_Pillow 53.0/100: 53% focus precise_shots, steady_focus
3:53.724 trickshots L multishot Fluffy_Pillow 60.5/100: 60% focus double_tap, precise_shots, steady_focus
3:54.914 trickshots O steady_shot Fluffy_Pillow 48.0/100: 48% focus double_tap, steady_focus, trick_shots
3:56.301 trickshots J aimed_shot Fluffy_Pillow 66.8/100: 67% focus double_tap, steady_focus, trick_shots
3:58.280 trickshots L multishot Fluffy_Pillow 44.3/100: 44% focus lock_and_load, precise_shots(2), steady_focus
3:59.469 trickshots J aimed_shot Fluffy_Pillow 31.9/100: 32% focus lock_and_load, precise_shots, steady_focus, trick_shots
4:00.658 trickshots L multishot Fluffy_Pillow 39.4/100: 39% focus precise_shots(2), steady_focus
4:01.846 trickshots O steady_shot Fluffy_Pillow 26.9/100: 27% focus precise_shots, steady_focus, trick_shots
4:03.232 trickshots F steady_shot Fluffy_Pillow 45.7/100: 46% focus precise_shots, steady_focus, trick_shots
4:04.619 trickshots H wild_spirits Fluffy_Pillow 64.5/100: 64% focus precise_shots, steady_focus, trick_shots
4:05.808 trickshots I trueshot Fluffy_Pillow 72.0/100: 72% focus precise_shots, steady_focus, trick_shots
4:05.808 cds D blood_fury Fluffy_Pillow 72.0/100: 72% focus precise_shots, steady_focus, trick_shots, trueshot
4:05.808 trickshots J aimed_shot Fluffy_Pillow 72.0/100: 72% focus blood_fury, precise_shots, steady_focus, trick_shots, trueshot
4:06.996 trickshots L multishot Fluffy_Pillow 48.3/100: 48% focus blood_fury, precise_shots(2), steady_focus, trueshot, wild_spirits
4:08.183 trickshots J aimed_shot Fluffy_Pillow 39.5/100: 40% focus blood_fury, precise_shots, steady_focus, trick_shots, trueshot, wild_spirits
4:09.371 trickshots O steady_shot Fluffy_Pillow 15.8/100: 16% focus blood_fury, precise_shots(2), steady_focus, trueshot, wild_spirits
4:10.756 trickshots L multishot Fluffy_Pillow 44.0/100: 44% focus blood_fury, precise_shots(2), steady_focus, trueshot, wild_spirits
4:11.944 trickshots J aimed_shot Fluffy_Pillow 35.2/100: 35% focus blood_fury, precise_shots, steady_focus, trick_shots, trueshot, wild_spirits
4:13.132 trickshots O steady_shot Fluffy_Pillow 11.5/100: 12% focus blood_fury, precise_shots(2), steady_focus, trueshot, wild_spirits
4:14.518 trickshots L multishot Fluffy_Pillow 39.7/100: 40% focus blood_fury, precise_shots(2), steady_focus, trueshot, wild_spirits
4:15.704 trickshots K rapid_fire Fluffy_Pillow 30.9/100: 31% focus blood_fury, precise_shots, steady_focus, trick_shots, trueshot, wild_spirits
4:17.534 trickshots L multishot Fluffy_Pillow 59.3/100: 59% focus blood_fury, precise_shots, steady_focus, trueshot, wild_spirits
4:18.722 trickshots J aimed_shot Fluffy_Pillow 50.6/100: 51% focus blood_fury, steady_focus, trick_shots, trueshot, wild_spirits
4:19.912 trickshots L multishot Fluffy_Pillow 26.7/100: 27% focus blood_fury, precise_shots(2), trueshot, wild_spirits
4:21.183 trickshots O steady_shot Fluffy_Pillow 18.0/100: 18% focus precise_shots, trick_shots, trueshot, wild_spirits
4:22.666 trickshots F steady_shot Fluffy_Pillow 46.1/100: 46% focus precise_shots, trick_shots, trueshot, wild_spirits
4:24.149 trickshots J aimed_shot Fluffy_Pillow 74.3/100: 74% focus precise_shots, steady_focus, trick_shots, trueshot
4:25.337 trickshots L multishot Fluffy_Pillow 50.6/100: 51% focus precise_shots(2), steady_focus, trueshot
4:26.525 trickshots K rapid_fire Fluffy_Pillow 38.5/100: 38% focus precise_shots, steady_focus, trick_shots
4:28.270 trickshots L multishot Fluffy_Pillow 56.5/100: 57% focus precise_shots, steady_focus
4:29.458 trickshots J aimed_shot Fluffy_Pillow 44.0/100: 44% focus steady_focus, trick_shots
4:31.433 trickshots L multishot Fluffy_Pillow 21.5/100: 22% focus precise_shots, steady_focus
4:32.621 default 9 use_items Fluffy_Pillow 9.1/100: 9% focus steady_focus, trick_shots
4:32.621 trickshots O steady_shot Fluffy_Pillow 9.1/100: 9% focus steady_focus, trick_shots
4:34.010 trickshots O steady_shot Fluffy_Pillow 27.8/100: 28% focus steady_focus, trick_shots
4:35.396 trickshots J aimed_shot Fluffy_Pillow 46.6/100: 47% focus steady_focus, trick_shots
4:37.376 trickshots L multishot Fluffy_Pillow 24.1/100: 24% focus precise_shots(2), steady_focus
4:38.566 trickshots O steady_shot Fluffy_Pillow 11.7/100: 12% focus precise_shots, steady_focus, trick_shots
4:39.952 trickshots O steady_shot Fluffy_Pillow 30.5/100: 30% focus precise_shots, steady_focus, trick_shots
4:41.338 trickshots O steady_shot Fluffy_Pillow 49.2/100: 49% focus precise_shots, steady_focus, trick_shots
4:42.726 trickshots L multishot Fluffy_Pillow 68.0/100: 68% focus precise_shots, steady_focus, trick_shots
4:43.915 trickshots J aimed_shot Fluffy_Pillow 55.5/100: 56% focus steady_focus, trick_shots
4:45.894 trickshots L multishot Fluffy_Pillow 33.1/100: 33% focus precise_shots(2), steady_focus
4:47.083 trickshots K rapid_fire Fluffy_Pillow 20.6/100: 21% focus precise_shots, steady_focus, trick_shots
4:49.009 trickshots L multishot Fluffy_Pillow 39.8/100: 40% focus precise_shots, steady_focus
4:50.199 trickshots M kill_shot Fluffy_Pillow 27.3/100: 27% focus steady_focus, trick_shots
4:51.388 trickshots O steady_shot Fluffy_Pillow 24.8/100: 25% focus steady_focus, trick_shots
4:52.774 trickshots F steady_shot Fluffy_Pillow 43.6/100: 44% focus steady_focus, trick_shots
4:54.161 trickshots G double_tap Fluffy_Pillow 62.4/100: 62% focus steady_focus, trick_shots
4:55.348 trickshots J aimed_shot Fluffy_Pillow 69.9/100: 70% focus double_tap, steady_focus, trick_shots
4:57.326 trickshots L multishot Fluffy_Pillow 47.4/100: 47% focus precise_shots, steady_focus
4:58.515 trickshots O steady_shot Fluffy_Pillow 34.9/100: 35% focus steady_focus, trick_shots
4:59.902 trickshots O steady_shot Fluffy_Pillow 53.7/100: 54% focus steady_focus, trick_shots
5:01.289 trickshots M kill_shot Fluffy_Pillow 72.5/100: 72% focus steady_focus, trick_shots
5:02.478 trickshots J aimed_shot Fluffy_Pillow 70.0/100: 70% focus steady_focus, trick_shots
5:04.457 trickshots L multishot Fluffy_Pillow 47.5/100: 48% focus precise_shots(2), steady_focus
5:05.647 trickshots O steady_shot Fluffy_Pillow 35.1/100: 35% focus precise_shots, steady_focus, trick_shots
5:07.032 trickshots K rapid_fire Fluffy_Pillow 53.8/100: 54% focus precise_shots, steady_focus, trick_shots
5:08.886 trickshots L multishot Fluffy_Pillow 72.6/100: 73% focus precise_shots, steady_focus
5:10.073 trickshots N multishot Fluffy_Pillow 60.1/100: 60% focus steady_focus, trick_shots
5:11.260 trickshots M kill_shot Fluffy_Pillow 47.6/100: 48% focus steady_focus, trick_shots
5:12.478 trickshots J aimed_shot Fluffy_Pillow 45.3/100: 45% focus lock_and_load, steady_focus, trick_shots
5:13.667 trickshots L multishot Fluffy_Pillow 52.8/100: 53% focus precise_shots(2), steady_focus
5:14.855 trickshots O steady_shot Fluffy_Pillow 40.4/100: 40% focus precise_shots, steady_focus, trick_shots
5:16.242 trickshots F steady_shot Fluffy_Pillow 59.1/100: 59% focus precise_shots, steady_focus, trick_shots
5:17.628 trickshots L multishot Fluffy_Pillow 77.4/100: 77% focus precise_shots, steady_focus, trick_shots
5:18.814 trickshots J aimed_shot Fluffy_Pillow 64.9/100: 65% focus steady_focus, trick_shots
5:20.793 trickshots L multishot Fluffy_Pillow 42.4/100: 42% focus precise_shots(2), steady_focus
5:21.983 trickshots M kill_shot Fluffy_Pillow 29.9/100: 30% focus precise_shots, steady_focus, trick_shots
5:23.172 trickshots O steady_shot Fluffy_Pillow 27.4/100: 27% focus precise_shots, steady_focus, trick_shots
5:24.559 trickshots O steady_shot Fluffy_Pillow 46.2/100: 46% focus precise_shots, steady_focus, trick_shots
5:25.946 trickshots L multishot Fluffy_Pillow 65.0/100: 65% focus precise_shots, steady_focus, trick_shots
5:27.134 cds E potion Fluffy_Pillow 52.5/100: 53% focus lock_and_load, steady_focus, trick_shots
5:27.134 trickshots J aimed_shot Fluffy_Pillow 52.5/100: 53% focus lock_and_load, steady_focus, trick_shots, potion_of_spectral_agility
5:28.323 trickshots L multishot Fluffy_Pillow 60.0/100: 60% focus precise_shots(2), steady_focus, potion_of_spectral_agility
5:29.512 trickshots K rapid_fire Fluffy_Pillow 47.6/100: 48% focus precise_shots, steady_focus, trick_shots, potion_of_spectral_agility
5:31.414 trickshots L multishot Fluffy_Pillow 66.6/100: 67% focus precise_shots, steady_focus, potion_of_spectral_agility
5:32.604 trickshots J aimed_shot Fluffy_Pillow 54.1/100: 54% focus steady_focus, trick_shots, potion_of_spectral_agility
5:34.582 trickshots L multishot Fluffy_Pillow 31.7/100: 32% focus precise_shots, steady_focus, potion_of_spectral_agility
5:35.771 trickshots M kill_shot Fluffy_Pillow 19.2/100: 19% focus steady_focus, trick_shots, potion_of_spectral_agility
5:36.959 trickshots O steady_shot Fluffy_Pillow 16.7/100: 17% focus steady_focus, trick_shots, potion_of_spectral_agility
5:38.345 trickshots F steady_shot Fluffy_Pillow 35.5/100: 35% focus steady_focus, trick_shots, potion_of_spectral_agility
5:39.729 trickshots J aimed_shot Fluffy_Pillow 54.2/100: 54% focus steady_focus, trick_shots, potion_of_spectral_agility
5:41.708 trickshots L multishot Fluffy_Pillow 31.8/100: 32% focus precise_shots, steady_focus, potion_of_spectral_agility
5:42.896 trickshots O steady_shot Fluffy_Pillow 19.3/100: 19% focus steady_focus, trick_shots, potion_of_spectral_agility
5:44.282 trickshots O steady_shot Fluffy_Pillow 38.1/100: 38% focus steady_focus, trick_shots, potion_of_spectral_agility
5:45.668 trickshots M kill_shot Fluffy_Pillow 56.8/100: 57% focus steady_focus, trick_shots, potion_of_spectral_agility
5:46.959 trickshots J aimed_shot Fluffy_Pillow 55.0/100: 55% focus steady_focus, trick_shots, potion_of_spectral_agility
5:48.938 trickshots L multishot Fluffy_Pillow 32.5/100: 33% focus precise_shots, steady_focus, potion_of_spectral_agility
5:50.125 trickshots K rapid_fire Fluffy_Pillow 20.0/100: 20% focus steady_focus, trick_shots, potion_of_spectral_agility
5:51.894 trickshots L multishot Fluffy_Pillow 38.2/100: 38% focus steady_focus, potion_of_spectral_agility

Stats

Level Bonus (60) Race Bonus (orc) Raid-Buffed Unbuffed Gear Amount
Strength 274 3 295 277 0
Agility 450 -3 1411 1297 789 (677)
Stamina 414 1 1800 1715 1300
Intellect 369 -1 405 368 0
Spirit 0 0 0 0 0
Health 36000 34300 0
Focus 100 100 0
Spell Power 405 368 0
Crit 22.66% 22.66% 443
Haste 18.30% 18.30% 604
Versatility 3.65% 3.65% 146
Attack Power 1482 1297 0
Mastery 14.00% 14.00% 504
Armor 813 813 813
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 217.00
Local Head Helm of Insatiable Appetite
ilevel: 213, stats: { 103 Armor, +126 Sta, +92 Haste, +40 Mastery, +72 AgiInt }
Local Neck Noble's Birthstone Pendant
ilevel: 213, stats: { +71 Sta, +47 Crit, +147 Mastery }
Local Shoulders Boneshatter Pauldrons
ilevel: 235, stats: { 102 Armor, +124 Sta, +44 unknown(24), +44 unknown(25), +66 AgiInt }
Local Chest Master Huntsman's Bandolier
ilevel: 213, stats: { 137 Armor, +126 Sta, +45 Crit, +86 Mastery, +72 AgiInt }, enchant: { +20 StrAgi }
Local Waist Load-Bearing Belt
ilevel: 213, stats: { 77 Armor, +95 Sta, +69 Haste, +30 Vers, +54 AgiInt }
Local Legs Greaves of Enigmatic Energies
ilevel: 213, stats: { 120 Armor, +126 Sta, +91 Crit, +41 Mastery, +72 AgiInt }
Local Feet Stoneclas Stompers
ilevel: 213, stats: { 86 Armor, +95 Sta, +69 Crit, +30 Mastery, +54 AgiInt }, enchant: { +15 Agi }
Local Wrists Bangles of Errant Pride
ilevel: 213, stats: { 69 Armor, +71 Sta, +48 Crit, +24 Mastery, +40 AgiInt }
Local Hands Oathsworn Soldier's Gauntlets
ilevel: 220, stats: { 80 Armor, +104 Sta, +67 Crit, +36 Haste, +58 AgiInt }
Local Finger1 Most Regal Signet of Sire Denathrius
ilevel: 220, stats: { +77 Sta, +161 Haste, +44 Mastery }, enchant: { +16 Crit }
item effects: { equip: Denathrius' Privilege }
Local Finger2 Ritualist's Treasured Ring
ilevel: 213, stats: { +71 Sta, +44 Crit, +149 Haste }, enchant: { +16 Crit }
Local Trinket1 Dreadfire Vessel
ilevel: 220, stats: { +73 StrAgiInt }, enchant: shadowcore_oil
item effects: { use: Dreadfire Vessel }
Local Trinket2 Stone Legion Heraldry
ilevel: 220, stats: { +73 StrAgi }
item effects: { equip: Stone Legionnaire }
Local Back Crest of the Legionnaire General
ilevel: 220, stats: { 39 Armor, +77 Sta, +52 Haste, +24 Vers, +43 StrAgiInt }
Local Main Hand Deadeye Blunderbuss
ilevel: 220, weapon: { 121 - 227, 3 }, stats: { +77 Agi, +137 Sta, +45 Haste, +92 Mastery }, enchant: sinful_revelation

Profile

hunter="no_lego"
source=default
spec=marksmanship
level=60
race=orc
role=attack
position=ranged_back
talents=1101032
covenant=night_fae
soulbind=140:6//188:6

# Default consumables
potion=spectral_agility
flask=spectral_flask_of_power
food=feast_of_gluttonous_hedonism
augmentation=veiled

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask
actions.precombat+=/augmentation
actions.precombat+=/food
# Snapshot raid buffed stats before combat begins and pre-potting is done.
actions.precombat+=/snapshot_stats
actions.precombat+=/tar_trap,if=runeforge.soulforge_embers
actions.precombat+=/double_tap,precast_time=10,if=!covenant.kyrian&(!talent.volley|active_enemies<2)
actions.precombat+=/aimed_shot,if=active_enemies<3
actions.precombat+=/steady_shot,if=active_enemies>2

# Executed every time the actor is available.
actions=auto_shot
actions+=/counter_shot,line_cd=30,if=runeforge.sephuzs_proclamation|soulbind.niyas_tools_poison|(conduit.reversal_of_fortune&!runeforge.sephuzs_proclamation)
actions+=/use_items
actions+=/call_action_list,name=cds
actions+=/call_action_list,name=st,if=active_enemies<3
actions+=/call_action_list,name=trickshots,if=active_enemies>2

actions.cds=berserking,if=buff.trueshot.up|target.time_to_die<13
actions.cds+=/blood_fury,if=buff.trueshot.up|target.time_to_die<16
actions.cds+=/ancestral_call,if=buff.trueshot.up|target.time_to_die<16
actions.cds+=/fireblood,if=buff.trueshot.up|target.time_to_die<9
actions.cds+=/lights_judgment,if=buff.trueshot.down
actions.cds+=/bag_of_tricks,if=buff.trueshot.down
actions.cds+=/potion,if=buff.trueshot.up&buff.bloodlust.up|buff.trueshot.up&target.health.pct<20|target.time_to_die<26

actions.st=steady_shot,if=talent.steady_focus&(prev_gcd.1.steady_shot&buff.steady_focus.remains<5|buff.steady_focus.down)
actions.st+=/kill_shot
actions.st+=/double_tap,if=covenant.kyrian&cooldown.resonating_arrow.remains<gcd|!covenant.kyrian&(cooldown.aimed_shot.up|cooldown.rapid_fire.remains>cooldown.aimed_shot.remains)
actions.st+=/flare,if=tar_trap.up&runeforge.soulforge_embers
actions.st+=/tar_trap,if=runeforge.soulforge_embers&tar_trap.remains<gcd&cooldown.flare.remains<gcd
actions.st+=/explosive_shot
actions.st+=/wild_spirits
actions.st+=/flayed_shot
actions.st+=/death_chakram,if=focus+cast_regen<focus.max
actions.st+=/volley,if=buff.precise_shots.down|!talent.chimaera_shot|active_enemies<2
actions.st+=/a_murder_of_crows
actions.st+=/resonating_arrow
actions.st+=/trueshot,if=buff.precise_shots.down|buff.resonating_arrow.up|buff.wild_spirits.up|buff.volley.up&active_enemies>1
actions.st+=/aimed_shot,target_if=min:(dot.serpent_sting.remains<?action.serpent_sting.in_flight_to_target*dot.serpent_sting.duration),if=buff.precise_shots.down|(buff.trueshot.up|full_recharge_time<gcd+cast_time)&(!talent.chimaera_shot|active_enemies<2)|buff.trick_shots.remains>execute_time&active_enemies>1
actions.st+=/rapid_fire,if=focus+cast_regen<focus.max&(buff.trueshot.down|!runeforge.eagletalons_true_focus)&(buff.double_tap.down|talent.streamline)
actions.st+=/chimaera_shot,if=buff.precise_shots.up|focus>cost+action.aimed_shot.cost
actions.st+=/arcane_shot,if=buff.precise_shots.up|focus>cost+action.aimed_shot.cost
actions.st+=/serpent_sting,target_if=min:remains,if=refreshable&target.time_to_die>duration
actions.st+=/barrage,if=active_enemies>1
actions.st+=/rapid_fire,if=focus+cast_regen<focus.max&(buff.double_tap.down|talent.streamline)
actions.st+=/steady_shot

actions.trickshots=steady_shot,if=talent.steady_focus&in_flight&buff.steady_focus.remains<5
actions.trickshots+=/double_tap,if=covenant.kyrian&cooldown.resonating_arrow.remains<gcd|cooldown.rapid_fire.remains<cooldown.aimed_shot.full_recharge_time|!(talent.streamline&runeforge.surging_shots)|!covenant.kyrian
actions.trickshots+=/tar_trap,if=runeforge.soulforge_embers&tar_trap.remains<gcd&cooldown.flare.remains<gcd
actions.trickshots+=/flare,if=tar_trap.up&runeforge.soulforge_embers
actions.trickshots+=/explosive_shot
actions.trickshots+=/wild_spirits
actions.trickshots+=/resonating_arrow
actions.trickshots+=/volley
actions.trickshots+=/barrage
actions.trickshots+=/trueshot
actions.trickshots+=/rapid_fire,if=buff.trick_shots.remains>=execute_time&runeforge.surging_shots&buff.double_tap.down
actions.trickshots+=/aimed_shot,target_if=min:(dot.serpent_sting.remains<?action.serpent_sting.in_flight_to_target*dot.serpent_sting.duration),if=buff.trick_shots.remains>=execute_time&(buff.precise_shots.down|full_recharge_time<cast_time+gcd|buff.trueshot.up)
actions.trickshots+=/death_chakram,if=focus+cast_regen<focus.max
actions.trickshots+=/rapid_fire,if=buff.trick_shots.remains>=execute_time
actions.trickshots+=/multishot,if=buff.trick_shots.down|buff.precise_shots.up&focus>cost+action.aimed_shot.cost&(!talent.chimaera_shot|active_enemies>3)
actions.trickshots+=/chimaera_shot,if=buff.precise_shots.up&focus>cost+action.aimed_shot.cost&active_enemies<4
actions.trickshots+=/kill_shot,if=buff.dead_eye.down
actions.trickshots+=/a_murder_of_crows
actions.trickshots+=/flayed_shot
actions.trickshots+=/serpent_sting,target_if=min:dot.serpent_sting.remains,if=refreshable
actions.trickshots+=/multishot,if=focus>cost+action.aimed_shot.cost
actions.trickshots+=/steady_shot

head=helm_of_insatiable_appetite,id=183001,bonus_id=7188/1485,ilevel=213
neck=nobles_birthstone_pendant,id=183039,bonus_id=7188/1485,ilevel=213
shoulders=boneshatter_pauldrons,id=172327,ilevel=235
back=crest_of_the_legionnaire_general,id=183032,bonus_id=6805,ilevel=220
chest=master_huntsmans_bandolier,id=182988,bonus_id=6805,ilevel=213,enchant=eternal_skirmish
wrists=bangles_of_errant_pride,id=182977,bonus_id=6805,ilevel=213
hands=oathsworn_soldiers_gauntlets,id=182991,bonus_id=6805,ilevel=220
waist=loadbearing_belt,id=183016,bonus_id=6805,ilevel=213
legs=greaves_of_enigmatic_energies,id=183012,bonus_id=6805,ilevel=213
feet=stoneclas_stompers,id=183006,bonus_id=6805,ilevel=213,enchant=15agility
finger1=most_regal_signet_of_sire_denathrius,id=183036,bonus_id=6805,ilevel=220,enchant=16crit
finger2=ritualists_treasured_ring,id=183037,bonus_id=6805,ilevel=213,enchant=16crit
trinket1=dreadfire_vessel,id=184030,bonus_id=6805,ilevel=220,enchant=shadowcore_oil
trinket2=stone_legion_heraldry,id=184027,bonus_id=6805,ilevel=220
main_hand=deadeye_blunderbuss,id=184250,bonus_id=6805,ilevel=220,enchant=sinful_revelation

# Gear Summary
# gear_ilvl=217.27
# gear_agility=789
# gear_stamina=1300
# gear_crit_rating=443
# gear_haste_rating=604
# gear_mastery_rating=504
# gear_versatility_rating=54
# gear_armor=813

secrets_ot_unblinking_vigil : 11721 dps, 3935 dps to main target

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
11721.3 11721.3 20.3 / 0.174% 1401.2 / 12.0% 1233.9
RPS Out RPS In Primary Resource Waiting APM Active Skill
9.5 9.3 Focus 0.00% 46.4 100.0% 100%
Talents
Night Fae
Runeforge

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
secrets_ot_unblinking_vigil 11721
Aimed Shot 4577 (4965) 39.1% (42.4%) 59.7 4.99sec 24922 15488 Direct 298.0 (322.4) 3754 7503 4601 22.6% (22.6%)

Stats Details: Aimed Shot

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 59.65 297.96 0.00 0.00 1.6091 0.0000 1370854.05 1958127.93 29.99% 15488.21 15488.21
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 77.41% 230.65 163 298 3753.68 2524 9967 3755.40 3562 3992 865842 1236769 29.99%
crit 22.59% 67.30 36 99 7503.44 5048 19934 7504.86 6307 8616 505012 721359 29.99%

Action Details: Aimed Shot

  • id:19434
  • school:physical
  • range:40.0
  • travel_speed:100.0000
  • radius:8.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:12.000
  • cooldown hasted:true
  • base_recharge_multiplier:1.000
  • base_execute_time:2.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:focus
  • base_cost:35.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:19434
  • name:Aimed Shot
  • school:physical
  • tooltip:
  • description:A powerful aimed shot that deals {$s1=0} Physical damage.

Action Priority List

    trickshots
    [J]:59.97
  • if_expr:buff.trick_shots.remains>=execute_time&(buff.precise_shots.down|full_recharge_time<cast_time+gcd|buff.trueshot.up)
  • target_if_expr:(dot.serpent_sting.remains<?action.serpent_sting.in_flight_to_target*dot.serpent_sting.duration)
    Aimed Shot (_double_tap) 388 3.3% 0.0 0.00sec 0 0 Direct 24.4 3873 7627 4745 23.2%

Stats Details: Aimed Shot Double Tap

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 0.00 24.42 0.00 0.00 0.0000 0.0000 115874.50 165515.14 29.99% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 76.77% 18.75 5 29 3872.68 2524 9967 3891.91 3053 5206 72605 103709 29.99%
crit 23.23% 5.67 0 13 7627.13 5048 19934 7658.64 0 19934 43269 61806 29.94%

Action Details: Aimed Shot Double Tap

  • id:19434
  • school:physical
  • range:40.0
  • travel_speed:100.0000
  • radius:8.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:12.000
  • cooldown hasted:true
  • base_recharge_multiplier:1.000
  • base_execute_time:2.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:focus
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:19434
  • name:Aimed Shot
  • school:physical
  • tooltip:
  • description:A powerful aimed shot that deals {$s1=0} Physical damage.
Auto Shot 373 3.2% 112.8 2.67sec 991 434 Direct 112.6 809 1619 993 22.7%

Stats Details: Auto Shot

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 112.81 112.57 0.00 0.00 2.2861 0.0000 111803.44 159700.03 29.99% 433.53 433.53
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 77.29% 87.00 63 122 809.35 774 1019 809.28 795 834 70418 100585 29.99%
crit 22.71% 25.57 10 46 1618.83 1548 2037 1618.32 1555 1686 41386 59115 29.99%

Action Details: Auto Shot

  • id:75
  • school:physical
  • range:40.0
  • travel_speed:60.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00

Spelldata

  • id:75
  • name:Auto Shot
  • school:physical
  • tooltip:Firing at the target.
  • description:Automatically shoots the target until cancelled.
Dreadfire Vessel 138 1.2% 3.7 90.74sec 11029 0 Direct 3.7 9031 18050 11050 22.5%

Stats Details: Dreadfire Vessel

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 3.73 3.72 0.00 0.00 0.0000 0.0000 41189.24 41189.24 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 77.52% 2.89 0 4 9031.26 8937 9474 9007.97 0 9474 26075 26075 0.00%
crit 22.48% 0.84 0 4 18049.75 17875 18947 10810.71 0 18947 15115 15115 0.00%

Action Details: Dreadfire Vessel

  • id:344732
  • school:fire
  • range:50.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:90.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:8212.26
  • base_dd_max:8212.26
  • base_dd_mult:1.00

Spelldata

  • id:344732
  • name:Dreadfire Vessel
  • school:fire
  • tooltip:
  • description:Unleash incendiary flames at your target inflicting {$s1=0} Fire damage.
Eternal Skirmish 40 0.3% 21.7 13.56sec 547 0 Direct 21.7 446 891 547 22.7%

Stats Details: Eternal Skirmish

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 21.71 21.71 0.00 0.00 0.0000 0.0000 11878.45 11878.45 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 77.28% 16.77 7 34 446.07 435 485 446.09 435 463 7483 7483 0.00%
crit 22.72% 4.93 0 15 891.35 871 969 881.77 0 946 4396 4396 0.00%

Action Details: Eternal Skirmish

  • id:323889
  • school:shadow
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:400.00
  • base_dd_max:400.00
  • base_dd_mult:1.00

Spelldata

  • id:323889
  • name:Eternal Skirmish
  • school:shadow
  • tooltip:
  • description:Deals {$s1=400} Shadow damage.
Kill Shot 70 0.6% 3.9 15.41sec 5430 4487 Direct 3.8 4245 9584 5455 22.7%

Stats Details: Kill Shot

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 3.86 3.84 0.00 0.00 1.2101 0.0000 20968.60 29951.55 29.99% 4487.18 4487.18
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 77.26% 2.97 0 6 4244.91 4065 4838 4194.57 0 4838 12597 17993 29.70%
crit 22.74% 0.87 0 4 9583.66 9146 10885 6010.70 0 10885 8372 11959 18.80%

Action Details: Kill Shot

  • id:53351
  • school:physical
  • range:40.0
  • travel_speed:80.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:10.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:focus
  • base_cost:10.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:53351
  • name:Kill Shot
  • school:physical
  • tooltip:
  • description:You attempt to finish off a wounded target, dealing {$s1=0} Physical damage. Only usable on enemies with less than {$s2=20}% health.

Action Priority List

    trickshots
    [M]:3.85
  • if_expr:buff.dead_eye.down
Master Marksman 537 4.6% 304.3 1.00sec 528 0 Periodic 523.5 307 0 307 0.0% 69.8%

Stats Details: Master Marksman

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 304.35 0.00 523.51 523.51 0.0000 2.0000 160844.41 160844.41 0.00% 153.62 0.00
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 100.00% 523.51 368 668 307.31 37 2772 307.38 253 363 160844 160844 0.00%

Action Details: Master Marksman

  • id:269576
  • school:physical
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:false
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:6.00
  • base_tick_time:2.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH

Spelldata

  • id:269576
  • name:Master Marksman
  • school:physical
  • tooltip:Bleeding for $w1 damage every $t1 sec.
  • description:{$@spelldesc260309=Your ranged special attack critical strikes cause the target to bleed for an additional {$s1=15}% of the damage dealt over {$269576d=6 seconds}.}
Multi-Shot 2879 24.6% 82.3 3.63sec 10489 9172 Direct 410.5 1714 3427 2102 22.7%

Stats Details: Multishot

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 82.27 410.46 0.00 0.00 1.1437 0.0000 862909.54 1232579.99 29.99% 9171.60 9171.60
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 77.35% 317.48 229 390 1714.25 953 2194 1714.13 1649 1764 544246 777401 29.99%
crit 22.65% 92.98 53 135 3427.17 1905 4389 3426.81 3255 3575 318664 455179 29.99%

Action Details: Multishot

  • id:257620
  • school:physical
  • range:40.0
  • travel_speed:50.0000
  • radius:10.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:5
  • harmful:true

Resources

  • resource:focus
  • base_cost:20.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:257620
  • name:Multi-Shot
  • school:physical
  • tooltip:
  • description:Fires several missiles, hitting your current target and up to $I enemies within $A1 yards for {$s1=0} Physical damage.

Action Priority List

    trickshots
    [L]:81.81
  • if_expr:buff.trick_shots.down|buff.precise_shots.up&focus>cost+action.aimed_shot.cost&(!talent.chimaera_shot|active_enemies>3)
    trickshots
    [N]:0.47
  • if_expr:focus>cost+action.aimed_shot.cost
Rapid Fire 1009 8.6% 15.2 19.75sec 19818 11267 Periodic 553.2 445 890 546 22.7% 1.5%

Stats Details: Rapid Fire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 15.25 0.00 110.99 553.21 1.7590 0.2070 302183.91 431639.50 29.99% 11266.69 11266.69
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 77.28% 427.54 241 626 445.03 351 925 444.96 429 459 190264 271773 29.99%
crit 22.72% 125.67 73 190 890.28 703 1850 890.58 808 1001 111920 159866 29.99%

Action Details: Rapid Fire

  • id:257044
  • school:physical
  • range:40.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:20.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:false
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:2.00
  • base_tick_time:0.33
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH

Spelldata

  • id:257044
  • name:Rapid Fire
  • school:physical
  • tooltip:Being targeted by Rapid Fire.
  • description:Shoot a stream of {$s1=7} shots at your target over {$d=2 seconds}, dealing a total of ${$m1*$257045sw1} Physical damage. {$?s321281=true}[ Each shot generates {$263585s1=1} Focus.][] Usable while moving.

Action Details: Rapid Fire Damage

  • id:257045
  • school:physical
  • range:40.0
  • travel_speed:40.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:on_hit
  • energize_resource:focus
  • energize_amount:1.0

Spelldata

  • id:257045
  • name:Rapid Fire
  • school:physical
  • tooltip:
  • description:{$@spelldesc257044=Shoot a stream of {$s1=7} shots at your target over {$d=2 seconds}, dealing a total of ${$m1*$257045sw1} Physical damage. {$?s321281=true}[ Each shot generates {$263585s1=1} Focus.][] Usable while moving.}

Action Priority List

    trickshots
    [K]:15.25
  • if_expr:buff.trick_shots.remains>=execute_time
Shadowcore Oil Blast 44 0.4% 43.4 6.89sec 301 0 Direct 43.4 245 491 301 22.5%

Stats Details: Shadowcore Oil Blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 43.44 43.44 0.00 0.00 0.0000 0.0000 13056.68 13056.68 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 77.49% 33.66 14 52 245.31 239 266 245.32 242 250 8257 8257 0.00%
crit 22.51% 9.78 2 24 490.71 479 533 490.72 479 507 4799 4799 0.00%

Action Details: Shadowcore Oil Blast

  • id:336463
  • school:shadow
  • range:60.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:220.00
  • base_dd_max:220.00
  • base_dd_mult:1.00

Spelldata

  • id:336463
  • name:Shadowcore Oil Blast
  • school:shadow
  • tooltip:
  • description:Deals {$s1=220} Shadow damage.
Steady Shot 266 2.3% 50.7 5.87sec 1578 1155 Direct 51.6 1260 2521 1550 23.0%

Stats Details: Steady Shot

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 50.66 51.57 0.00 0.00 1.3661 0.0000 79950.67 114201.54 29.99% 1155.29 1155.29
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 77.00% 39.71 22 63 1260.27 1219 1605 1259.82 1227 1298 50043 71481 29.99%
crit 23.00% 11.86 3 23 2520.81 2439 3210 2519.70 2439 2720 29908 42720 29.99%

Action Details: Steady Shot

  • id:56641
  • school:physical
  • range:40.0
  • travel_speed:75.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:1.75
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:on_cast
  • energize_resource:focus
  • energize_amount:10.0

Spelldata

  • id:56641
  • name:Steady Shot
  • school:physical
  • tooltip:
  • description:A steady shot that causes {$s1=0} Physical damage. Usable while moving.{$?s321018=true}[ |cFFFFFFFFGenerates {$s2=0} Focus.][]

Action Priority List

    trickshots
    [F]:16.43
  • if_expr:talent.steady_focus&in_flight&buff.steady_focus.remains<5
    trickshots
    [O]:34.41
Wild Spirits 49 (1402) 0.4% (11.9%) 3.0 120.68sec 140180 126798 Direct 14.8 (233.4) 807 1616 988 22.4% (22.5%)

Stats Details: Wild Spirits

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.98 14.82 0.00 0.00 1.1058 0.0000 14640.91 14640.91 0.00% 126797.97 126797.97
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 77.64% 11.50 4 15 807.44 776 910 807.62 784 842 9287 9287 0.00%
crit 22.36% 3.31 0 9 1615.94 1552 1820 1578.63 0 1820 5353 5353 0.00%

Action Details: Wild Spirits

  • id:328231
  • school:nature
  • range:40.0
  • travel_speed:30.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:120.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:328231
  • name:Wild Spirits
  • school:nature
  • tooltip:
  • description:Evoke the energy of Wild Spirits at the target location, dealing {$328837s3=0} Nature damage and apply Hunter's Mark to all enemy targets within the area for {$328837d=15 seconds}. While the Wild Spirits are active, each damaging ability you or your pet use against a target in the area will strike up to $328757I nearby targets for {$328757s1=0} Nature damage.

Action Details: Wild Spirits Damage

  • id:328837
  • school:nature
  • range:100.0
  • travel_speed:0.0000
  • radius:12.0
  • trigger_gcd:0.0000
  • gcd_type:attack_haste
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:328837
  • name:Wild Spirits
  • school:nature
  • tooltip:
  • description:{$@spelldesc328231=Evoke the energy of Wild Spirits at the target location, dealing {$328837s3=0} Nature damage and apply Hunter's Mark to all enemy targets within the area for {$328837d=15 seconds}. While the Wild Spirits are active, each damaging ability you or your pet use against a target in the area will strike up to $328757I nearby targets for {$328757s1=0} Nature damage.}

Action Priority List

    trickshots
    [H]:2.98
    Wild Spirits (_proc) 1353 11.5% 43.7 5.88sec 9218 0 Direct 218.5 1504 3010 1844 22.5%

Stats Details: Wild Spirits Proc

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 43.71 218.54 0.00 0.00 0.0000 0.0000 402904.80 402904.80 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 77.47% 169.30 104 200 1504.36 1355 1699 1505.01 1484 1547 254688 254688 0.00%
crit 22.53% 49.24 21 74 3009.54 2711 3398 3011.29 2940 3125 148216 148216 0.00%

Action Details: Wild Spirits Proc

  • id:328757
  • school:nature
  • range:40.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:attack_haste
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:5
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:328757
  • name:Wild Spirits
  • school:nature
  • tooltip:
  • description:{$@spelldesc328231=Evoke the energy of Wild Spirits at the target location, dealing {$328837s3=0} Nature damage and apply Hunter's Mark to all enemy targets within the area for {$328837d=15 seconds}. While the Wild Spirits are active, each damaging ability you or your pet use against a target in the area will strike up to $328757I nearby targets for {$328757s1=0} Nature damage.}
Simple Action Stats Execute Interval
secrets_ot_unblinking_vigil
Veiled Augmentation (augmentation) 1.0 0.00sec

Stats Details: Augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Augmentation

  • id:347901
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:secrets_ot_unblinking_vigil
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Blood Fury 3.0 120.80sec

Stats Details: Blood Fury

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.97 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Blood Fury

  • id:20572
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:120.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:20572
  • name:Blood Fury
  • school:physical
  • tooltip:Attack power increased by $w1.
  • description:Increases your attack power by {$s1=122} for {$d=15 seconds}.

Action Priority List

    cds
    [D]:2.97
  • if_expr:buff.trueshot.up|target.time_to_die<16
Double Tap 5.6 60.60sec

Stats Details: Double Tap

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 5.59 0.00 0.00 0.00 0.9805 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Double Tap

  • id:260402
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:60.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:260402
  • name:Double Tap
  • school:physical
  • tooltip:Your next Aimed Shot will fire a second time instantly at {$s4=100}% power and consume no Focus, or your next Rapid Fire will shoot {$s3=100}% additional shots during its channel.
  • description:Your next Aimed Shot will fire a second time instantly at {$s4=100}% power without consuming Focus, or your next Rapid Fire will shoot {$s3=100}% additional shots during its channel.

Action Priority List

    trickshots
    [G]:4.60
  • if_expr:covenant.kyrian&cooldown.resonating_arrow.remains<gcd|cooldown.rapid_fire.remains<cooldown.aimed_shot.full_recharge_time|!(talent.streamline&runeforge.surging_shots)|!covenant.kyrian
Spectral Flask of Power (flask) 1.0 0.00sec

Stats Details: Flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Flask

  • id:307185
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:secrets_ot_unblinking_vigil
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Feast of Gluttonous Hedonism (food) 1.0 0.00sec

Stats Details: Food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Food

  • id:308462
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:secrets_ot_unblinking_vigil
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Potion of Spectral Agility (potion) 1.5 309.92sec

Stats Details: Potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.48 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Potion

  • id:307159
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:300.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Action Priority List

    cds
    [E]:1.47
  • if_expr:buff.trueshot.up&buff.bloodlust.up|buff.trueshot.up&target.health.pct<20|target.time_to_die<26
Trueshot 3.0 120.83sec

Stats Details: Trueshot

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.96 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Trueshot

  • id:288613
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:attack_haste
  • min_gcd:0.0000
  • cooldown:120.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:288613
  • name:Trueshot
  • school:physical
  • tooltip:The cooldown of Aimed Shot and Rapid Fire is reduced by ${$m1/4}%, and Aimed Shot casts {$s4=50}% faster. All Focus generation is increased by {$s5=50}%.
  • description:Reduces the cooldown of your Aimed Shot and Rapid Fire by ${$m1/4}%, and causes Aimed Shot to cast {$s4=50}% faster for {$d=15 seconds}. While Trueshot is active, you generate {$s5=50}% additional Focus.

Action Priority List

    trickshots
    [I]:2.96

Buffs

Dynamic Buffs Start Refresh Interval Trigger Avg Dur Up-Time Benefit Overflow Expiry
Blood Fury 3.0 0.0 120.8sec 120.8sec 14.7sec 14.64% 0.00% 0.0 (0.0) 2.8

Buff Details

  • buff initial source:secrets_ot_unblinking_vigil
  • cooldown name:buff_blood_fury
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:120.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:attack_power
  • amount:122.00

Trigger Details

  • interval_min/max:120.0s / 122.9s
  • trigger_min/max:120.0s / 122.9s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 15.0s

Stack Uptimes

  • blood_fury_1:14.64%

Spelldata

  • id:20572
  • name:Blood Fury
  • tooltip:Attack power increased by $w1.
  • description:Increases your attack power by {$s1=122} for {$d=15 seconds}.
  • max_stacks:0
  • duration:15.00
  • cooldown:120.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 40.0sec 13.52% 0.00% 0.0 (0.0) 1.0

Buff Details

  • buff initial source:secrets_ot_unblinking_vigil
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • base duration:40.00
  • duration modifier:1.00
  • base cooldown:300.00
  • default_chance:100.00%
  • default_value:0.30
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:40.0s / 40.0s

Stack Uptimes

  • bloodlust_1:13.52%

Spelldata

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by $w1%.
  • description:Increases haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Double Tap 5.6 0.0 58.5sec 60.6sec 4.0sec 7.56% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:secrets_ot_unblinking_vigil
  • cooldown name:buff_double_tap
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.50
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:50.0s / 62.7s
  • trigger_min/max:60.0s / 62.7s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 11.3s

Stack Uptimes

  • double_tap_1:7.56%

Spelldata

  • id:260402
  • name:Double Tap
  • tooltip:Your next Aimed Shot will fire a second time instantly at {$s4=100}% power and consume no Focus, or your next Rapid Fire will shoot {$s3=100}% additional shots during its channel.
  • description:Your next Aimed Shot will fire a second time instantly at {$s4=100}% power without consuming Focus, or your next Rapid Fire will shoot {$s3=100}% additional shots during its channel.
  • max_stacks:0
  • duration:15.00
  • cooldown:60.00
  • default_chance:0.00%
Well Fed (feast_of_gluttonous_hedonism) 1.0 0.0 0.0sec 0.0sec 300.0sec 100.00% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:secrets_ot_unblinking_vigil
  • cooldown name:buff_feast_of_gluttonous_hedonism
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:agility
  • amount:20.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:240.1s / 359.8s

Stack Uptimes

  • feast_of_gluttonous_hedonism_1:100.00%

Spelldata

  • id:327709
  • name:Well Fed
  • tooltip:Agility increased by $w1.
  • description:Agility increased by {$s1=20}. Lasts {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Lock and Load 8.7 0.2 30.9sec 30.1sec 1.8sec 5.19% 14.35% 0.2 (0.2) 0.0

Buff Details

  • buff initial source:secrets_ot_unblinking_vigil
  • cooldown name:buff_lock_and_load
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:8.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:1.8s / 260.5s
  • trigger_min/max:1.8s / 260.5s
  • trigger_pct:7.94%
  • duration_min/max:0.0s / 11.4s

Stack Uptimes

  • lock_and_load_1:5.19%

Spelldata

  • id:194594
  • name:Lock and Load
  • tooltip:Aimed Shot costs no Focus and is instant.
  • description:{$@spelldesc194595=Your ranged auto attacks have a {$194595h=8}% chance to trigger Lock and Load, causing your next Aimed Shot to cost no Focus and be instant.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%

Trigger Spelldata

  • id:194595
  • name:Lock and Load
  • tooltip:
  • description:Your ranged auto attacks have a {$194595h=8}% chance to trigger Lock and Load, causing your next Aimed Shot to cost no Focus and be instant.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:8.00%
Potion of Spectral Agility 1.5 0.0 309.3sec 309.3sec 23.3sec 11.24% 0.00% 0.0 (0.0) 1.2

Buff Details

  • buff initial source:secrets_ot_unblinking_vigil
  • cooldown name:buff_potion_of_spectral_agility
  • max_stacks:1
  • base duration:25.00
  • duration modifier:1.00
  • base cooldown:1.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:agility
  • amount:190.00

Trigger Details

  • interval_min/max:300.0s / 332.4s
  • trigger_min/max:300.0s / 332.4s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 25.0s

Stack Uptimes

  • potion_of_spectral_agility_1:11.24%

Spelldata

  • id:307159
  • name:Potion of Spectral Agility
  • tooltip:Agility increased by $w1.
  • description:Increases your Agility by {$s1=190} for {$d=25 seconds}.
  • max_stacks:0
  • duration:25.00
  • cooldown:1.00
  • default_chance:0.00%
Precise Shots 38.0 21.7 7.8sec 5.0sec 4.2sec 53.66% 94.86% 10.9 (10.9) 0.0

Buff Details

  • buff initial source:secrets_ot_unblinking_vigil
  • cooldown name:buff_precise_shots
  • max_stacks:2
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.50
  • default_chance:101.00%
  • default_value:0.75
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.9s / 51.3s
  • trigger_min/max:0.9s / 12.9s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 52.7s

Stack Uptimes

  • precise_shots_1:46.04%
  • precise_shots_2:7.62%

Spelldata

  • id:260242
  • name:Precise Shots
  • tooltip:Damage of {$?s342049=false}[Chimaera Shot][Arcane Shot] or Multi-Shot increased by {$s1=75}%.
  • description:{$@spelldesc260240=Aimed Shot causes your next 1-{$260242u=2} {$?s342049=false}[Chimaera Shots][Arcane Shots] or Multi-Shots to deal {$260242s1=75}% more damage.}
  • max_stacks:2
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
Secrets of the Unblinking Vigil 32.6 8.6 9.1sec 7.2sec 2.0sec 22.07% 32.99% 8.6 (8.6) 0.0

Buff Details

  • buff initial source:secrets_ot_unblinking_vigil
  • cooldown name:buff_secrets_of_the_unblinking_vigil
  • max_stacks:1
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:50.00%
  • default_value:-1.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:1.8s / 65.5s
  • trigger_min/max:0.9s / 65.5s
  • trigger_pct:49.97%
  • duration_min/max:0.0s / 8.2s

Stack Uptimes

  • secrets_of_the_unblinking_vigil_1:22.07%

Spelldata

  • id:336892
  • name:Secrets of the Unblinking Vigil
  • tooltip:Your next Aimed Shot will consume {$s1=100}% less Focus.
  • description:{$@spelldesc336878=When you gain the Trick Shots effect, you have a {$h=50}% chance to refund a charge of Aimed Shot, and cause your next Aimed Shot to not consume any Focus.}
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%

Trigger Spelldata

  • id:336878
  • name:Secrets of the Unblinking Vigil
  • tooltip:
  • description:When you gain the Trick Shots effect, you have a {$h=50}% chance to refund a charge of Aimed Shot, and cause your next Aimed Shot to not consume any Focus.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:50.00%
Spectral Flask of Power 1.0 0.0 0.0sec 0.0sec 300.0sec 100.00% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:secrets_ot_unblinking_vigil
  • cooldown name:buff_spectral_flask_of_power
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:agility
  • amount:70.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:240.1s / 359.8s

Stack Uptimes

  • spectral_flask_of_power_1:100.00%

Spelldata

  • id:307185
  • name:Spectral Flask of Power
  • tooltip:$pri increased by $w1.
  • description:Increases $pri by {$s1=70} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Steady Focus 9.0 11.2 34.9sec 15.0sec 28.2sec 84.61% 0.00% 11.2 (11.2) 8.2

Buff Details

  • buff initial source:secrets_ot_unblinking_vigil
  • cooldown name:buff_steady_focus
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.07
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:15.0s / 222.3s
  • trigger_min/max:4.0s / 54.5s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 219.6s

Stack Uptimes

  • steady_focus_1:84.61%

Spelldata

  • id:193534
  • name:Steady Focus
  • tooltip:Haste increased by {$s1=7}%.
  • description:{$@spelldesc193533=Using Steady Shot twice in a row increases your Haste by {$193534s1=7}% for {$193534d=15 seconds}.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%

Trigger Spelldata

  • id:193533
  • name:Steady Focus
  • tooltip:
  • description:Using Steady Shot twice in a row increases your Haste by {$193534s1=7}% for {$193534d=15 seconds}.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
Trick Shots 75.7 6.6 3.9sec 3.6sec 3.4sec 86.97% 100.00% 6.6 (6.6) 0.0

Buff Details

  • buff initial source:secrets_ot_unblinking_vigil
  • cooldown name:buff_trick_shots
  • max_stacks:1
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:1.8s / 11.4s
  • trigger_min/max:0.9s / 10.1s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 11.3s

Stack Uptimes

  • trick_shots_1:86.97%

Spelldata

  • id:257622
  • name:Trick Shots
  • tooltip:Your next Aimed Shot or Rapid Fire will ricochet and hit {$257621s1=5} additional targets for {$257621s4=50}% of normal damage.
  • description:{$@spelldesc257621=When Multi-Shot hits {$s2=3} or more targets, your next Aimed Shot or Rapid Fire will ricochet and hit up to {$s1=5} additional targets for {$s4=50}% of normal damage.}
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
Trueshot 3.0 0.0 120.8sec 120.8sec 19.1sec 18.98% 0.00% 0.0 (0.0) 2.8

Buff Details

  • buff initial source:secrets_ot_unblinking_vigil
  • cooldown name:buff_trueshot
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.31
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.50
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:120.0s / 122.9s
  • trigger_min/max:120.0s / 122.9s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 19.7s

Stack Uptimes

  • trueshot_1:18.98%

Spelldata

  • id:288613
  • name:Trueshot
  • tooltip:The cooldown of Aimed Shot and Rapid Fire is reduced by ${$m1/4}%, and Aimed Shot casts {$s4=50}% faster. All Focus generation is increased by {$s5=50}%.
  • description:Reduces the cooldown of your Aimed Shot and Rapid Fire by ${$m1/4}%, and causes Aimed Shot to cast {$s4=50}% faster for {$d=15 seconds}. While Trueshot is active, you generate {$s5=50}% additional Focus.
  • max_stacks:0
  • duration:15.00
  • cooldown:120.00
  • default_chance:0.00%
Veiled Augmentation 1.0 0.0 0.0sec 0.0sec 300.0sec 100.00% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:secrets_ot_unblinking_vigil
  • cooldown name:buff_veiled_augmentation
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:agility
  • amount:18.00
  • stat:strength
  • amount:18.00
  • stat:intellect
  • amount:18.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:240.1s / 359.8s

Stack Uptimes

  • veiled_augmentation_1:100.00%

Spelldata

  • id:347901
  • name:Veiled Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=18} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Wild Spirits 3.0 0.0 120.7sec 120.7sec 17.5sec 17.43% 0.00% 0.0 (0.0) 2.8

Buff Details

  • buff initial source:secrets_ot_unblinking_vigil
  • cooldown name:buff_wild_spirits
  • max_stacks:1
  • base duration:18.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:120.0s / 122.8s
  • trigger_min/max:120.0s / 122.8s
  • trigger_pct:100.00%
  • duration_min/max:0.3s / 18.0s

Stack Uptimes

  • wild_spirits_1:17.43%

Spelldata

  • id:328837
  • name:Wild Spirits
  • tooltip:
  • description:{$@spelldesc328231=Evoke the energy of Wild Spirits at the target location, dealing {$328837s3=0} Nature damage and apply Hunter's Mark to all enemy targets within the area for {$328837d=15 seconds}. While the Wild Spirits are active, each damaging ability you or your pet use against a target in the area will strike up to $328757I nearby targets for {$328757s1=0} Nature damage.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
Windfury Totem 1.0 0.0 0.0sec 0.0sec 300.0sec 100.00% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:secrets_ot_unblinking_vigil
  • cooldown name:buff_windfury_totem
  • max_stacks:1
  • base duration:900.00
  • duration modifier:1.00
  • base cooldown:0.50
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:240.1s / 359.8s

Stack Uptimes

  • windfury_totem_1:100.00%

Spelldata

  • id:327942
  • name:Windfury Totem
  • tooltip:Your auto-attacks have a {$h=10}% chance to instantly attack again.
  • description:{$@spelldesc8512=Summons a Windfury Totem with {$s1=5} health at the feet of the caster for {$d=120 seconds}. Party members within {$s2=30} yds have a {$327942h=10}% chance when they auto-attack to swing an extra time.}
  • max_stacks:0
  • duration:120.00
  • cooldown:0.00
  • default_chance:10.00%
Constant Buffs
Arcane Intellect

Buff Details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff Details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:15.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
Power Word: Fortitude

Buff Details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.$?$w2>0[ Magic damage taken reduced by $w2%.][]
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Procs, Uptimes & Benefits

Proc Count Min Max Interval Min Max
double_tap_aimed 4.9 2.0 7.0 65.7s 47.1s 242.2s
double_tap_rapid_fire 0.6 0.0 3.0 113.4s 56.8s 246.0s
Uptime Avg % Min Max Avg Dur Min Max
Focus Cap 0.88% 0.68% 1.68% 0.8s 0.0s 2.4s

Cooldown waste details

Seconds per ExecuteSeconds per Iteration
AbilityAverageMinimumMaximumAverageMinimumMaximum
Double Tap0.7550.0012.7012.9420.0347.421
Aimed Shot1.6130.0019.97162.64926.006103.607
Kill Shot5.7030.00141.54315.4270.00041.543
Wild Spirits0.7900.0012.7521.3160.0004.952
Trueshot0.8530.0012.9461.5920.2715.228
Rapid Fire4.2840.00137.89458.24021.661112.088

Resources

Gains Type Count Total Tot% Avg Overflow Ovr%
secrets_ot_unblinking_vigil
steady_shot Focus 51.63 496.34 17.87% 9.61 20.00 3.87%
rapid_fire Focus 110.97 110.83 3.99% 1.00 0.13 0.12%
focus_regen Focus 593.84 1932.39 69.56% 3.25 19.28 0.99%
Trueshot Focus 185.75 238.55 8.59% 1.28 1.13 0.47%
Change Start Gain/s Loss/s Overflow (Total) End (Avg) Min Max
Focus 100.0 9.26 9.48 40.5 34.5 0.0 100.0
Usage Type Count Total Avg RPE APR
secrets_ot_unblinking_vigil
aimed_shot Focus 59.7 1159.4 19.4 19.4 1282.3
kill_shot Focus 3.9 38.5 10.0 10.0 544.1
multishot Focus 82.3 1645.7 20.0 20.0 524.3

Statistics & Data Analysis

Fight Length
secrets_ot_unblinking_vigil Fight Length
Count 1217
Mean 299.97
Minimum 240.10
Maximum 359.83
Spread ( max - min ) 119.74
Range [ ( max - min ) / 2 * 100% ] 19.96%
DPS
secrets_ot_unblinking_vigil Damage Per Second
Count 1217
Mean 11721.28
Minimum 10800.93
Maximum 13258.64
Spread ( max - min ) 2457.71
Range [ ( max - min ) / 2 * 100% ] 10.48%
Standard Deviation 362.0902
5th Percentile 11113.91
95th Percentile 12323.63
( 95th Percentile - 5th Percentile ) 1209.72
Mean Distribution
Standard Deviation 10.3794
95.00% Confidence Interval ( 11700.94 - 11741.62 )
Normalized 95.00% Confidence Interval ( 99.83% - 100.17% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 37
0.1% Error 3666
0.1 Scale Factor Error with Delta=300 1120
0.05 Scale Factor Error with Delta=300 4477
0.01 Scale Factor Error with Delta=300 111923
Priority Target DPS
secrets_ot_unblinking_vigil Priority Target Damage Per Second
Count 1217
Mean 3934.76
Minimum 3570.82
Maximum 4436.27
Spread ( max - min ) 865.45
Range [ ( max - min ) / 2 * 100% ] 11.00%
Standard Deviation 135.6786
5th Percentile 3704.90
95th Percentile 4163.74
( 95th Percentile - 5th Percentile ) 458.85
Mean Distribution
Standard Deviation 3.8893
95.00% Confidence Interval ( 3927.14 - 3942.39 )
Normalized 95.00% Confidence Interval ( 99.81% - 100.19% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 46
0.1% Error 4568
0.1 Scale Factor Error with Delta=300 158
0.05 Scale Factor Error with Delta=300 629
0.01 Scale Factor Error with Delta=300 15715
DPS(e)
secrets_ot_unblinking_vigil Damage Per Second (Effective)
Count 1217
Mean 11721.28
Minimum 10800.93
Maximum 13258.64
Spread ( max - min ) 2457.71
Range [ ( max - min ) / 2 * 100% ] 10.48%
Damage
secrets_ot_unblinking_vigil Damage
Count 1217
Mean 3509059.22
Minimum 2683565.72
Maximum 4227885.81
Spread ( max - min ) 1544320.09
Range [ ( max - min ) / 2 * 100% ] 22.00%
DTPS
secrets_ot_unblinking_vigil Damage Taken Per Second
Count 1217
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
secrets_ot_unblinking_vigil Healing Per Second
Count 1217
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
secrets_ot_unblinking_vigil Healing Per Second (Effective)
Count 1217
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
secrets_ot_unblinking_vigil Heal
Count 1217
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
secrets_ot_unblinking_vigil Healing Taken Per Second
Count 1217
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
secrets_ot_unblinking_vigil Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
secrets_ot_unblinking_vigilTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
secrets_ot_unblinking_vigil Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask
1 0.00 augmentation
2 0.00 food
3 0.00 snapshot_stats
Snapshot raid buffed stats before combat begins and pre-potting is done.
4 0.00 tar_trap,if=runeforge.soulforge_embers
5 0.00 double_tap,precast_time=10,if=!covenant.kyrian&(!talent.volley|active_enemies<2)
6 0.00 aimed_shot,if=active_enemies<3
7 0.00 steady_shot,if=active_enemies>2
Default action list Executed every time the actor is available.
# count action,conditions
8 1.00 auto_shot
0.00 counter_shot,line_cd=30,if=runeforge.sephuzs_proclamation|soulbind.niyas_tools_poison|(conduit.reversal_of_fortune&!runeforge.sephuzs_proclamation)
9 3.74 use_items
A 0.00 call_action_list,name=cds
B 0.00 call_action_list,name=st,if=active_enemies<3
C 0.00 call_action_list,name=trickshots,if=active_enemies>2
actions.cds
# count action,conditions
0.00 berserking,if=buff.trueshot.up|target.time_to_die<13
D 2.97 blood_fury,if=buff.trueshot.up|target.time_to_die<16
0.00 ancestral_call,if=buff.trueshot.up|target.time_to_die<16
0.00 fireblood,if=buff.trueshot.up|target.time_to_die<9
0.00 lights_judgment,if=buff.trueshot.down
0.00 bag_of_tricks,if=buff.trueshot.down
E 1.47 potion,if=buff.trueshot.up&buff.bloodlust.up|buff.trueshot.up&target.health.pct<20|target.time_to_die<26
actions.trickshots
# count action,conditions
F 16.43 steady_shot,if=talent.steady_focus&in_flight&buff.steady_focus.remains<5
G 4.60 double_tap,if=covenant.kyrian&cooldown.resonating_arrow.remains<gcd|cooldown.rapid_fire.remains<cooldown.aimed_shot.full_recharge_time|!(talent.streamline&runeforge.surging_shots)|!covenant.kyrian
0.00 tar_trap,if=runeforge.soulforge_embers&tar_trap.remains<gcd&cooldown.flare.remains<gcd
0.00 flare,if=tar_trap.up&runeforge.soulforge_embers
0.00 explosive_shot
H 2.98 wild_spirits
0.00 resonating_arrow
0.00 volley
0.00 barrage
I 2.96 trueshot
0.00 rapid_fire,if=buff.trick_shots.remains>=execute_time&runeforge.surging_shots&buff.double_tap.down
J 59.97 aimed_shot,target_if=min:(dot.serpent_sting.remains<?action.serpent_sting.in_flight_to_target*dot.serpent_sting.duration),if=buff.trick_shots.remains>=execute_time&(buff.precise_shots.down|full_recharge_time<cast_time+gcd|buff.trueshot.up)
0.00 death_chakram,if=focus+cast_regen<focus.max
K 15.25 rapid_fire,if=buff.trick_shots.remains>=execute_time
L 81.81 multishot,if=buff.trick_shots.down|buff.precise_shots.up&focus>cost+action.aimed_shot.cost&(!talent.chimaera_shot|active_enemies>3)
0.00 chimaera_shot,if=buff.precise_shots.up&focus>cost+action.aimed_shot.cost&active_enemies<4
M 3.85 kill_shot,if=buff.dead_eye.down
0.00 a_murder_of_crows
0.00 flayed_shot
0.00 serpent_sting,target_if=min:dot.serpent_sting.remains,if=refreshable
N 0.47 multishot,if=focus>cost+action.aimed_shot.cost
O 34.41 steady_shot

Sample Sequence

0125789FHIDELJLJLJLKLJOFLJLJLJOLJLJLJLKLJLOFJLOJLOOJLOKLGJLOFOLJLJLJLKLOFJLOJLOOOLJL9KLOFJLOOJLJLOOGJLKLJLJHIDLJLJLKLOFJLJLKLJLOFLJLJLKLJLJOFLJGLJLJLK9LOFJLOJOLJLOFKLJLJLJLOFJLOJLKLJLOFGJLOJLOFHIDJLKLJLOFJLJOLJLJLJLKL9JOFLJLJMOLJLJLGJLKLJLMOFJLOJLOKLJLMOEFJLOOLJLKLJLJLMOFJ

Sample Sequence Table

Time List # Name Target Resources Buffs
Pre precombat 0 flask secrets_ot_unblinking_vigil 100.0/100: 100% focus
Pre precombat 1 augmentation secrets_ot_unblinking_vigil 100.0/100: 100% focus
Pre precombat 2 food secrets_ot_unblinking_vigil 100.0/100: 100% focus
Pre precombat 5 double_tap Fluffy_Pillow 100.0/100: 100% focus
Pre precombat 7 steady_shot Fluffy_Pillow 100.0/100: 100% focus double_tap
0:00.000 default 8 auto_attack Fluffy_Pillow 100.0/100: 100% focus double_tap
0:00.000 default 9 use_items Fluffy_Pillow 100.0/100: 100% focus double_tap
0:00.000 trickshots F steady_shot Fluffy_Pillow 100.0/100: 100% focus double_tap
0:01.481 trickshots H wild_spirits Fluffy_Pillow 100.0/100: 100% focus bloodlust, double_tap, steady_focus
0:02.397 trickshots I trueshot Fluffy_Pillow 100.0/100: 100% focus bloodlust, double_tap, steady_focus
0:02.397 cds D blood_fury Fluffy_Pillow 100.0/100: 100% focus bloodlust, double_tap, steady_focus, trueshot
0:02.397 cds E potion Fluffy_Pillow 100.0/100: 100% focus bloodlust, blood_fury, double_tap, steady_focus, trueshot
0:02.397 trickshots L multishot Fluffy_Pillow 100.0/100: 100% focus bloodlust, blood_fury, double_tap, steady_focus, trueshot, potion_of_spectral_agility
0:03.313 trickshots J aimed_shot Fluffy_Pillow 91.3/100: 91% focus bloodlust, blood_fury, double_tap, steady_focus, trick_shots, trueshot, wild_spirits, secrets_of_the_unblinking_vigil, potion_of_spectral_agility
0:04.229 trickshots L multishot Fluffy_Pillow 100.0/100: 100% focus bloodlust, blood_fury, precise_shots(2), steady_focus, trueshot, wild_spirits, secrets_of_the_unblinking_vigil, potion_of_spectral_agility
0:05.145 trickshots J aimed_shot Fluffy_Pillow 91.3/100: 91% focus bloodlust, blood_fury, precise_shots, steady_focus, trick_shots, trueshot, wild_spirits, potion_of_spectral_agility
0:06.060 trickshots L multishot Fluffy_Pillow 66.9/100: 67% focus bloodlust, blood_fury, precise_shots(2), steady_focus, trueshot, wild_spirits, potion_of_spectral_agility
0:06.973 trickshots J aimed_shot Fluffy_Pillow 58.2/100: 58% focus bloodlust, blood_fury, precise_shots, steady_focus, trick_shots, trueshot, wild_spirits, potion_of_spectral_agility
0:07.889 trickshots L multishot Fluffy_Pillow 34.5/100: 34% focus bloodlust, blood_fury, precise_shots(2), steady_focus, trueshot, wild_spirits, potion_of_spectral_agility
0:08.804 trickshots K rapid_fire Fluffy_Pillow 25.8/100: 26% focus bloodlust, blood_fury, precise_shots, steady_focus, trick_shots, trueshot, wild_spirits, potion_of_spectral_agility
0:10.167 trickshots L multishot Fluffy_Pillow 51.6/100: 52% focus bloodlust, blood_fury, precise_shots, steady_focus, trueshot, wild_spirits, potion_of_spectral_agility
0:11.082 trickshots J aimed_shot Fluffy_Pillow 42.9/100: 43% focus bloodlust, blood_fury, steady_focus, trick_shots, trueshot, wild_spirits, potion_of_spectral_agility
0:11.995 trickshots O steady_shot Fluffy_Pillow 19.2/100: 19% focus bloodlust, blood_fury, precise_shots, steady_focus, trueshot, wild_spirits, potion_of_spectral_agility
0:13.061 trickshots F steady_shot Fluffy_Pillow 47.3/100: 47% focus bloodlust, blood_fury, precise_shots, steady_focus, trueshot, wild_spirits, potion_of_spectral_agility
0:14.127 trickshots L multishot Fluffy_Pillow 75.5/100: 75% focus bloodlust, blood_fury, precise_shots, steady_focus, trueshot, wild_spirits, potion_of_spectral_agility
0:15.045 trickshots J aimed_shot Fluffy_Pillow 66.8/100: 67% focus bloodlust, blood_fury, steady_focus, trick_shots, trueshot, wild_spirits, secrets_of_the_unblinking_vigil, potion_of_spectral_agility
0:15.959 trickshots L multishot Fluffy_Pillow 78.1/100: 78% focus bloodlust, blood_fury, precise_shots, steady_focus, trueshot, wild_spirits, secrets_of_the_unblinking_vigil, potion_of_spectral_agility
0:16.876 trickshots J aimed_shot Fluffy_Pillow 69.4/100: 69% focus bloodlust, blood_fury, steady_focus, trick_shots, trueshot, wild_spirits, potion_of_spectral_agility
0:17.791 trickshots L multishot Fluffy_Pillow 45.7/100: 46% focus bloodlust, precise_shots(2), steady_focus, trueshot, wild_spirits, potion_of_spectral_agility
0:18.705 trickshots J aimed_shot Fluffy_Pillow 37.0/100: 37% focus bloodlust, precise_shots, steady_focus, trick_shots, trueshot, wild_spirits, potion_of_spectral_agility
0:19.620 trickshots O steady_shot Fluffy_Pillow 13.3/100: 13% focus bloodlust, precise_shots(2), steady_focus, trueshot, wild_spirits, potion_of_spectral_agility
0:20.690 trickshots L multishot Fluffy_Pillow 41.5/100: 41% focus bloodlust, lock_and_load, precise_shots(2), steady_focus, trueshot, wild_spirits, potion_of_spectral_agility
0:21.605 trickshots J aimed_shot Fluffy_Pillow 32.8/100: 33% focus bloodlust, lock_and_load, precise_shots, steady_focus, trick_shots, trueshot, potion_of_spectral_agility
0:22.520 trickshots L multishot Fluffy_Pillow 42.1/100: 42% focus bloodlust, precise_shots(2), steady_focus, potion_of_spectral_agility
0:23.437 trickshots J aimed_shot Fluffy_Pillow 29.7/100: 30% focus bloodlust, lock_and_load, precise_shots, steady_focus, trick_shots, potion_of_spectral_agility
0:24.351 trickshots L multishot Fluffy_Pillow 37.2/100: 37% focus bloodlust, precise_shots(2), steady_focus, potion_of_spectral_agility
0:25.267 trickshots J aimed_shot Fluffy_Pillow 24.7/100: 25% focus bloodlust, lock_and_load, precise_shots, steady_focus, trick_shots, potion_of_spectral_agility
0:26.184 trickshots L multishot Fluffy_Pillow 32.3/100: 32% focus bloodlust, precise_shots(2), steady_focus, potion_of_spectral_agility
0:27.099 trickshots K rapid_fire Fluffy_Pillow 19.8/100: 20% focus bloodlust, precise_shots, steady_focus, trick_shots, potion_of_spectral_agility
0:28.557 trickshots L multishot Fluffy_Pillow 38.8/100: 39% focus bloodlust, precise_shots, steady_focus
0:29.473 trickshots J aimed_shot Fluffy_Pillow 26.1/100: 26% focus bloodlust, trick_shots, secrets_of_the_unblinking_vigil
0:31.102 trickshots L multishot Fluffy_Pillow 38.7/100: 39% focus bloodlust, precise_shots, secrets_of_the_unblinking_vigil
0:32.081 trickshots O steady_shot Fluffy_Pillow 26.2/100: 26% focus bloodlust, trick_shots
0:33.224 trickshots F steady_shot Fluffy_Pillow 45.0/100: 45% focus bloodlust, trick_shots
0:34.366 trickshots J aimed_shot Fluffy_Pillow 63.8/100: 64% focus bloodlust, steady_focus, trick_shots
0:35.887 trickshots L multishot Fluffy_Pillow 41.3/100: 41% focus bloodlust, precise_shots, steady_focus
0:36.801 trickshots O steady_shot Fluffy_Pillow 28.8/100: 29% focus bloodlust, steady_focus, trick_shots
0:37.867 trickshots J aimed_shot Fluffy_Pillow 47.6/100: 48% focus bloodlust, steady_focus, trick_shots
0:39.390 trickshots L multishot Fluffy_Pillow 25.1/100: 25% focus bloodlust, precise_shots, steady_focus
0:40.306 trickshots O steady_shot Fluffy_Pillow 12.7/100: 13% focus bloodlust, steady_focus, trick_shots
0:41.374 trickshots O steady_shot Fluffy_Pillow 30.7/100: 31% focus steady_focus, trick_shots
0:42.760 trickshots J aimed_shot Fluffy_Pillow 49.5/100: 50% focus steady_focus, trick_shots
0:44.740 trickshots L multishot Fluffy_Pillow 27.0/100: 27% focus precise_shots, steady_focus
0:45.929 trickshots O steady_shot Fluffy_Pillow 14.6/100: 15% focus steady_focus, trick_shots
0:47.315 trickshots K rapid_fire Fluffy_Pillow 33.3/100: 33% focus steady_focus, trick_shots
0:49.138 trickshots L multishot Fluffy_Pillow 51.9/100: 52% focus steady_focus
0:50.326 trickshots G double_tap Fluffy_Pillow 39.4/100: 39% focus steady_focus, trick_shots
0:51.515 trickshots J aimed_shot Fluffy_Pillow 46.9/100: 47% focus double_tap, steady_focus, trick_shots
0:53.495 trickshots L multishot Fluffy_Pillow 24.4/100: 24% focus precise_shots(2), steady_focus
0:54.684 trickshots O steady_shot Fluffy_Pillow 12.0/100: 12% focus precise_shots, steady_focus, trick_shots
0:56.071 trickshots F steady_shot Fluffy_Pillow 30.7/100: 31% focus precise_shots, steady_focus, trick_shots
0:57.457 trickshots O steady_shot Fluffy_Pillow 49.5/100: 50% focus precise_shots, steady_focus, trick_shots
0:58.843 trickshots L multishot Fluffy_Pillow 68.3/100: 68% focus precise_shots, steady_focus, trick_shots
1:00.032 trickshots J aimed_shot Fluffy_Pillow 55.8/100: 56% focus lock_and_load, steady_focus, trick_shots
1:01.218 trickshots L multishot Fluffy_Pillow 63.3/100: 63% focus precise_shots, steady_focus
1:02.407 trickshots J aimed_shot Fluffy_Pillow 50.9/100: 51% focus steady_focus, trick_shots, secrets_of_the_unblinking_vigil
1:04.386 trickshots L multishot Fluffy_Pillow 63.4/100: 63% focus precise_shots, steady_focus, secrets_of_the_unblinking_vigil
1:05.574 trickshots J aimed_shot Fluffy_Pillow 50.9/100: 51% focus steady_focus, trick_shots
1:07.554 trickshots L multishot Fluffy_Pillow 28.4/100: 28% focus precise_shots, steady_focus
1:08.742 trickshots K rapid_fire Fluffy_Pillow 15.9/100: 16% focus steady_focus, trick_shots
1:10.617 trickshots L multishot Fluffy_Pillow 34.8/100: 35% focus steady_focus
1:11.805 trickshots O steady_shot Fluffy_Pillow 22.3/100: 22% focus steady_focus, trick_shots
1:13.193 trickshots F steady_shot Fluffy_Pillow 40.8/100: 41% focus trick_shots
1:14.675 trickshots J aimed_shot Fluffy_Pillow 59.6/100: 60% focus steady_focus, trick_shots
1:16.654 trickshots L multishot Fluffy_Pillow 37.1/100: 37% focus precise_shots, steady_focus
1:17.841 trickshots O steady_shot Fluffy_Pillow 24.6/100: 25% focus steady_focus, trick_shots
1:19.228 trickshots J aimed_shot Fluffy_Pillow 43.4/100: 43% focus steady_focus, trick_shots
1:21.205 trickshots L multishot Fluffy_Pillow 20.9/100: 21% focus precise_shots(2), steady_focus
1:22.394 trickshots O steady_shot Fluffy_Pillow 8.4/100: 8% focus precise_shots, steady_focus, trick_shots
1:23.782 trickshots O steady_shot Fluffy_Pillow 27.2/100: 27% focus precise_shots, steady_focus, trick_shots
1:25.169 trickshots O steady_shot Fluffy_Pillow 46.0/100: 46% focus precise_shots, steady_focus, trick_shots
1:26.554 trickshots L multishot Fluffy_Pillow 64.8/100: 65% focus precise_shots, steady_focus, trick_shots
1:27.743 trickshots J aimed_shot Fluffy_Pillow 52.3/100: 52% focus steady_focus, trick_shots
1:29.722 trickshots L multishot Fluffy_Pillow 29.8/100: 30% focus precise_shots(2), steady_focus
1:30.912 default 9 use_items Fluffy_Pillow 17.3/100: 17% focus precise_shots, steady_focus, trick_shots
1:30.912 trickshots K rapid_fire Fluffy_Pillow 17.3/100: 17% focus precise_shots, steady_focus, trick_shots
1:32.809 trickshots L multishot Fluffy_Pillow 36.4/100: 36% focus precise_shots, steady_focus
1:33.997 trickshots O steady_shot Fluffy_Pillow 23.9/100: 24% focus steady_focus, trick_shots
1:35.384 trickshots F steady_shot Fluffy_Pillow 42.7/100: 43% focus steady_focus, trick_shots
1:36.770 trickshots J aimed_shot Fluffy_Pillow 61.4/100: 61% focus steady_focus, trick_shots
1:38.750 trickshots L multishot Fluffy_Pillow 39.0/100: 39% focus precise_shots(2), steady_focus
1:39.938 trickshots O steady_shot Fluffy_Pillow 26.5/100: 26% focus precise_shots, steady_focus, trick_shots
1:41.323 trickshots O steady_shot Fluffy_Pillow 45.2/100: 45% focus precise_shots, steady_focus, trick_shots
1:42.710 trickshots J aimed_shot Fluffy_Pillow 64.0/100: 64% focus precise_shots, steady_focus, trick_shots
1:44.686 trickshots L multishot Fluffy_Pillow 41.5/100: 42% focus precise_shots(2), steady_focus
1:45.875 trickshots J aimed_shot Fluffy_Pillow 29.1/100: 29% focus lock_and_load, precise_shots, steady_focus, trick_shots
1:47.065 trickshots L multishot Fluffy_Pillow 36.6/100: 37% focus precise_shots(2), steady_focus
1:48.254 trickshots O steady_shot Fluffy_Pillow 24.1/100: 24% focus precise_shots, steady_focus, trick_shots
1:49.640 trickshots O steady_shot Fluffy_Pillow 42.9/100: 43% focus precise_shots, steady_focus, trick_shots
1:51.027 trickshots G double_tap Fluffy_Pillow 61.7/100: 62% focus lock_and_load, precise_shots, steady_focus, trick_shots
1:52.215 trickshots J aimed_shot Fluffy_Pillow 69.2/100: 69% focus double_tap, lock_and_load, precise_shots, steady_focus, trick_shots
1:53.406 trickshots L multishot Fluffy_Pillow 76.7/100: 77% focus precise_shots(2), steady_focus
1:54.596 trickshots K rapid_fire Fluffy_Pillow 64.2/100: 64% focus precise_shots, steady_focus, trick_shots
1:56.426 trickshots L multishot Fluffy_Pillow 82.8/100: 83% focus precise_shots, steady_focus
1:57.615 trickshots J aimed_shot Fluffy_Pillow 70.4/100: 70% focus steady_focus, trick_shots, secrets_of_the_unblinking_vigil
1:59.593 trickshots L multishot Fluffy_Pillow 82.9/100: 83% focus precise_shots, steady_focus, secrets_of_the_unblinking_vigil
2:00.782 trickshots J aimed_shot Fluffy_Pillow 70.4/100: 70% focus steady_focus, trick_shots
2:02.759 trickshots H wild_spirits Fluffy_Pillow 47.9/100: 48% focus precise_shots, steady_focus
2:03.947 trickshots I trueshot Fluffy_Pillow 55.4/100: 55% focus precise_shots, steady_focus
2:03.947 cds D blood_fury Fluffy_Pillow 55.4/100: 55% focus precise_shots, steady_focus, trueshot
2:03.947 trickshots L multishot Fluffy_Pillow 55.4/100: 55% focus blood_fury, precise_shots, steady_focus, trueshot
2:05.135 trickshots J aimed_shot Fluffy_Pillow 46.7/100: 47% focus blood_fury, steady_focus, trick_shots, trueshot, wild_spirits, secrets_of_the_unblinking_vigil
2:06.323 trickshots L multishot Fluffy_Pillow 57.8/100: 58% focus blood_fury, precise_shots(2), trueshot, wild_spirits, secrets_of_the_unblinking_vigil
2:07.595 trickshots J aimed_shot Fluffy_Pillow 49.1/100: 49% focus blood_fury, precise_shots, trick_shots, trueshot, wild_spirits
2:08.866 trickshots L multishot Fluffy_Pillow 25.4/100: 25% focus blood_fury, precise_shots(2), trueshot, wild_spirits
2:10.138 trickshots K rapid_fire Fluffy_Pillow 16.7/100: 17% focus blood_fury, precise_shots, trick_shots, trueshot, wild_spirits
2:12.006 trickshots L multishot Fluffy_Pillow 41.2/100: 41% focus blood_fury, precise_shots, trueshot, wild_spirits
2:13.277 trickshots O steady_shot Fluffy_Pillow 32.5/100: 33% focus blood_fury, trick_shots, trueshot, wild_spirits
2:14.758 trickshots F steady_shot Fluffy_Pillow 60.6/100: 61% focus blood_fury, trick_shots, trueshot, wild_spirits
2:16.242 trickshots J aimed_shot Fluffy_Pillow 88.8/100: 89% focus blood_fury, steady_focus, trick_shots, trueshot, wild_spirits
2:17.431 trickshots L multishot Fluffy_Pillow 65.1/100: 65% focus blood_fury, precise_shots(2), steady_focus, trueshot, wild_spirits
2:18.620 trickshots J aimed_shot Fluffy_Pillow 56.4/100: 56% focus blood_fury, precise_shots, steady_focus, trick_shots, trueshot, wild_spirits
2:19.808 trickshots L multishot Fluffy_Pillow 32.7/100: 33% focus precise_shots(2), steady_focus, trueshot, wild_spirits
2:20.997 trickshots K rapid_fire Fluffy_Pillow 24.0/100: 24% focus precise_shots, steady_focus, trick_shots, trueshot, wild_spirits
2:22.813 trickshots L multishot Fluffy_Pillow 50.2/100: 50% focus precise_shots, steady_focus, trueshot
2:24.002 trickshots J aimed_shot Fluffy_Pillow 40.2/100: 40% focus steady_focus, trick_shots, secrets_of_the_unblinking_vigil
2:25.979 trickshots L multishot Fluffy_Pillow 52.7/100: 53% focus precise_shots(2), steady_focus, secrets_of_the_unblinking_vigil
2:27.166 trickshots O steady_shot Fluffy_Pillow 40.2/100: 40% focus precise_shots, steady_focus, trick_shots
2:28.552 trickshots F steady_shot Fluffy_Pillow 59.0/100: 59% focus precise_shots, steady_focus, trick_shots
2:29.940 trickshots L multishot Fluffy_Pillow 77.8/100: 78% focus precise_shots, steady_focus, trick_shots
2:31.129 trickshots J aimed_shot Fluffy_Pillow 65.3/100: 65% focus steady_focus, trick_shots, secrets_of_the_unblinking_vigil
2:33.105 trickshots L multishot Fluffy_Pillow 77.8/100: 78% focus precise_shots, steady_focus, secrets_of_the_unblinking_vigil
2:34.293 trickshots J aimed_shot Fluffy_Pillow 65.3/100: 65% focus steady_focus, trick_shots
2:36.271 trickshots L multishot Fluffy_Pillow 42.9/100: 43% focus precise_shots(2), steady_focus
2:37.461 trickshots K rapid_fire Fluffy_Pillow 30.4/100: 30% focus precise_shots, steady_focus, trick_shots
2:39.243 trickshots L multishot Fluffy_Pillow 48.7/100: 49% focus precise_shots, steady_focus
2:40.434 trickshots J aimed_shot Fluffy_Pillow 36.2/100: 36% focus steady_focus, trick_shots, secrets_of_the_unblinking_vigil
2:42.412 trickshots L multishot Fluffy_Pillow 48.7/100: 49% focus precise_shots, steady_focus, secrets_of_the_unblinking_vigil
2:43.602 trickshots J aimed_shot Fluffy_Pillow 36.3/100: 36% focus steady_focus, trick_shots
2:45.579 trickshots O steady_shot Fluffy_Pillow 13.5/100: 14% focus precise_shots
2:47.063 trickshots F steady_shot Fluffy_Pillow 32.3/100: 32% focus precise_shots
2:48.547 trickshots L multishot Fluffy_Pillow 51.1/100: 51% focus precise_shots, steady_focus
2:49.736 trickshots J aimed_shot Fluffy_Pillow 38.6/100: 39% focus steady_focus, trick_shots, secrets_of_the_unblinking_vigil
2:51.715 trickshots G double_tap Fluffy_Pillow 51.1/100: 51% focus precise_shots(2), steady_focus, secrets_of_the_unblinking_vigil
2:52.905 trickshots L multishot Fluffy_Pillow 58.6/100: 59% focus double_tap, precise_shots(2), steady_focus
2:54.095 trickshots J aimed_shot Fluffy_Pillow 46.2/100: 46% focus double_tap, precise_shots, steady_focus, trick_shots, secrets_of_the_unblinking_vigil
2:56.073 trickshots L multishot Fluffy_Pillow 58.7/100: 59% focus precise_shots(2), steady_focus, secrets_of_the_unblinking_vigil
2:57.262 trickshots J aimed_shot Fluffy_Pillow 46.2/100: 46% focus precise_shots, steady_focus, trick_shots
2:59.240 trickshots L multishot Fluffy_Pillow 23.7/100: 24% focus precise_shots(2), steady_focus
3:00.430 trickshots K rapid_fire Fluffy_Pillow 11.3/100: 11% focus precise_shots, steady_focus, trick_shots
3:02.188 default 9 use_items Fluffy_Pillow 29.4/100: 29% focus precise_shots, steady_focus
3:02.188 trickshots L multishot Fluffy_Pillow 29.4/100: 29% focus precise_shots, steady_focus
3:03.378 trickshots O steady_shot Fluffy_Pillow 16.9/100: 17% focus steady_focus, trick_shots
3:04.764 trickshots F steady_shot Fluffy_Pillow 35.2/100: 35% focus trick_shots
3:06.248 trickshots J aimed_shot Fluffy_Pillow 54.0/100: 54% focus steady_focus, trick_shots
3:08.226 trickshots L multishot Fluffy_Pillow 31.5/100: 31% focus precise_shots(2), steady_focus
3:09.414 trickshots O steady_shot Fluffy_Pillow 19.0/100: 19% focus precise_shots, steady_focus, trick_shots
3:10.799 trickshots J aimed_shot Fluffy_Pillow 37.8/100: 38% focus precise_shots, steady_focus, trick_shots
3:12.777 trickshots O steady_shot Fluffy_Pillow 15.3/100: 15% focus precise_shots(2), steady_focus
3:14.164 trickshots L multishot Fluffy_Pillow 34.1/100: 34% focus precise_shots(2), steady_focus
3:15.353 trickshots J aimed_shot Fluffy_Pillow 21.6/100: 22% focus precise_shots, steady_focus, trick_shots, secrets_of_the_unblinking_vigil
3:17.331 trickshots L multishot Fluffy_Pillow 34.1/100: 34% focus precise_shots(2), steady_focus, secrets_of_the_unblinking_vigil
3:18.519 trickshots O steady_shot Fluffy_Pillow 21.6/100: 22% focus precise_shots, steady_focus, trick_shots
3:19.905 trickshots F steady_shot Fluffy_Pillow 40.4/100: 40% focus precise_shots, steady_focus, trick_shots
3:21.292 trickshots K rapid_fire Fluffy_Pillow 59.2/100: 59% focus precise_shots, steady_focus, trick_shots
3:23.248 trickshots L multishot Fluffy_Pillow 78.6/100: 79% focus precise_shots, steady_focus
3:24.437 trickshots J aimed_shot Fluffy_Pillow 66.1/100: 66% focus steady_focus, trick_shots
3:26.417 trickshots L multishot Fluffy_Pillow 43.6/100: 44% focus lock_and_load, precise_shots, steady_focus
3:27.605 trickshots J aimed_shot Fluffy_Pillow 31.1/100: 31% focus lock_and_load, steady_focus, trick_shots
3:28.795 trickshots L multishot Fluffy_Pillow 38.7/100: 39% focus precise_shots, steady_focus
3:29.984 trickshots J aimed_shot Fluffy_Pillow 26.2/100: 26% focus steady_focus, trick_shots, secrets_of_the_unblinking_vigil
3:31.962 trickshots L multishot Fluffy_Pillow 38.7/100: 39% focus precise_shots(2), steady_focus, secrets_of_the_unblinking_vigil
3:33.150 trickshots O steady_shot Fluffy_Pillow 26.2/100: 26% focus precise_shots, steady_focus, trick_shots
3:34.539 trickshots F steady_shot Fluffy_Pillow 45.0/100: 45% focus precise_shots, steady_focus, trick_shots
3:35.926 trickshots J aimed_shot Fluffy_Pillow 63.8/100: 64% focus precise_shots, steady_focus, trick_shots
3:37.905 trickshots L multishot Fluffy_Pillow 41.3/100: 41% focus precise_shots(2), steady_focus
3:39.093 trickshots O steady_shot Fluffy_Pillow 28.8/100: 29% focus precise_shots, steady_focus, trick_shots
3:40.481 trickshots J aimed_shot Fluffy_Pillow 47.6/100: 48% focus precise_shots, steady_focus, trick_shots
3:42.458 trickshots L multishot Fluffy_Pillow 25.1/100: 25% focus precise_shots(2), steady_focus
3:43.647 trickshots K rapid_fire Fluffy_Pillow 12.7/100: 13% focus precise_shots, steady_focus, trick_shots
3:45.330 trickshots L multishot Fluffy_Pillow 30.3/100: 30% focus precise_shots, steady_focus
3:46.519 trickshots J aimed_shot Fluffy_Pillow 17.8/100: 18% focus steady_focus, trick_shots, secrets_of_the_unblinking_vigil
3:48.498 trickshots L multishot Fluffy_Pillow 30.4/100: 30% focus precise_shots, steady_focus, secrets_of_the_unblinking_vigil
3:49.687 trickshots O steady_shot Fluffy_Pillow 17.9/100: 18% focus steady_focus, trick_shots
3:51.072 trickshots F steady_shot Fluffy_Pillow 36.6/100: 37% focus trick_shots
3:52.556 trickshots G double_tap Fluffy_Pillow 55.4/100: 55% focus steady_focus, trick_shots
3:53.746 trickshots J aimed_shot Fluffy_Pillow 62.9/100: 63% focus double_tap, steady_focus, trick_shots
3:55.725 trickshots L multishot Fluffy_Pillow 40.4/100: 40% focus precise_shots(2), steady_focus
3:56.913 trickshots O steady_shot Fluffy_Pillow 28.0/100: 28% focus precise_shots, steady_focus, trick_shots
3:58.300 trickshots J aimed_shot Fluffy_Pillow 46.7/100: 47% focus precise_shots, steady_focus, trick_shots
4:00.278 trickshots L multishot Fluffy_Pillow 24.3/100: 24% focus precise_shots(2), steady_focus
4:01.467 trickshots O steady_shot Fluffy_Pillow 11.8/100: 12% focus precise_shots, steady_focus, trick_shots
4:02.853 trickshots F steady_shot Fluffy_Pillow 30.5/100: 31% focus precise_shots, steady_focus, trick_shots
4:04.241 trickshots H wild_spirits Fluffy_Pillow 49.3/100: 49% focus precise_shots, steady_focus, trick_shots
4:05.429 trickshots I trueshot Fluffy_Pillow 56.9/100: 57% focus precise_shots, steady_focus, trick_shots
4:05.429 cds D blood_fury Fluffy_Pillow 56.9/100: 57% focus precise_shots, steady_focus, trick_shots, trueshot
4:05.429 trickshots J aimed_shot Fluffy_Pillow 56.9/100: 57% focus blood_fury, precise_shots, steady_focus, trick_shots, trueshot
4:06.617 trickshots L multishot Fluffy_Pillow 33.1/100: 33% focus blood_fury, precise_shots(2), steady_focus, trueshot, wild_spirits
4:07.806 trickshots K rapid_fire Fluffy_Pillow 24.4/100: 24% focus blood_fury, precise_shots, steady_focus, trick_shots, trueshot, wild_spirits
4:09.637 trickshots L multishot Fluffy_Pillow 52.8/100: 53% focus blood_fury, precise_shots, steady_focus, trueshot, wild_spirits
4:10.825 trickshots J aimed_shot Fluffy_Pillow 44.1/100: 44% focus blood_fury, steady_focus, trick_shots, trueshot, wild_spirits
4:12.014 trickshots L multishot Fluffy_Pillow 20.4/100: 20% focus blood_fury, precise_shots(2), steady_focus, trueshot, wild_spirits
4:13.204 trickshots O steady_shot Fluffy_Pillow 11.7/100: 12% focus blood_fury, precise_shots, steady_focus, trick_shots, trueshot, wild_spirits
4:14.591 trickshots F steady_shot Fluffy_Pillow 39.8/100: 40% focus blood_fury, precise_shots, steady_focus, trick_shots, trueshot, wild_spirits
4:15.978 trickshots J aimed_shot Fluffy_Pillow 68.0/100: 68% focus blood_fury, precise_shots, steady_focus, trick_shots, trueshot, wild_spirits
4:17.167 trickshots L multishot Fluffy_Pillow 44.3/100: 44% focus blood_fury, precise_shots(2), steady_focus, trueshot, wild_spirits
4:18.354 trickshots J aimed_shot Fluffy_Pillow 35.6/100: 36% focus blood_fury, precise_shots, steady_focus, trick_shots, trueshot, wild_spirits
4:19.543 trickshots O steady_shot Fluffy_Pillow 11.8/100: 12% focus blood_fury, precise_shots(2), steady_focus, trueshot, wild_spirits
4:20.931 trickshots L multishot Fluffy_Pillow 40.0/100: 40% focus precise_shots(2), steady_focus, trueshot, wild_spirits
4:22.118 trickshots J aimed_shot Fluffy_Pillow 31.3/100: 31% focus precise_shots, steady_focus, trick_shots, trueshot, wild_spirits, secrets_of_the_unblinking_vigil
4:23.306 trickshots L multishot Fluffy_Pillow 42.6/100: 43% focus precise_shots(2), steady_focus, trueshot, wild_spirits, secrets_of_the_unblinking_vigil
4:24.495 trickshots J aimed_shot Fluffy_Pillow 33.9/100: 34% focus lock_and_load, precise_shots, steady_focus, trick_shots, trueshot
4:25.684 trickshots L multishot Fluffy_Pillow 43.2/100: 43% focus precise_shots(2), steady_focus
4:26.871 trickshots J aimed_shot Fluffy_Pillow 30.7/100: 31% focus precise_shots, steady_focus, trick_shots, secrets_of_the_unblinking_vigil
4:28.848 trickshots L multishot Fluffy_Pillow 43.3/100: 43% focus precise_shots(2), steady_focus, secrets_of_the_unblinking_vigil
4:30.036 trickshots K rapid_fire Fluffy_Pillow 30.8/100: 31% focus precise_shots, steady_focus, trick_shots
4:31.893 trickshots L multishot Fluffy_Pillow 49.2/100: 49% focus precise_shots
4:33.165 default 9 use_items Fluffy_Pillow 36.7/100: 37% focus trick_shots
4:33.165 trickshots J aimed_shot Fluffy_Pillow 36.7/100: 37% focus trick_shots
4:35.281 trickshots O steady_shot Fluffy_Pillow 14.2/100: 14% focus precise_shots(2)
4:36.765 trickshots F steady_shot Fluffy_Pillow 33.0/100: 33% focus precise_shots(2)
4:38.249 trickshots L multishot Fluffy_Pillow 51.8/100: 52% focus precise_shots(2), steady_focus
4:39.437 trickshots J aimed_shot Fluffy_Pillow 39.3/100: 39% focus precise_shots, steady_focus, trick_shots, secrets_of_the_unblinking_vigil
4:41.415 trickshots L multishot Fluffy_Pillow 51.8/100: 52% focus precise_shots(2), steady_focus, secrets_of_the_unblinking_vigil
4:42.603 trickshots J aimed_shot Fluffy_Pillow 39.3/100: 39% focus precise_shots, steady_focus, trick_shots
4:44.583 trickshots M kill_shot Fluffy_Pillow 16.8/100: 17% focus lock_and_load, precise_shots(2), steady_focus
4:45.771 trickshots O steady_shot Fluffy_Pillow 14.4/100: 14% focus lock_and_load, precise_shots(2), steady_focus
4:47.158 trickshots L multishot Fluffy_Pillow 33.1/100: 33% focus lock_and_load, precise_shots(2), steady_focus
4:48.346 trickshots J aimed_shot Fluffy_Pillow 20.7/100: 21% focus lock_and_load, precise_shots, steady_focus, trick_shots, secrets_of_the_unblinking_vigil
4:49.535 trickshots L multishot Fluffy_Pillow 28.2/100: 28% focus lock_and_load, precise_shots(2), steady_focus
4:50.721 trickshots J aimed_shot Fluffy_Pillow 15.7/100: 16% focus lock_and_load, precise_shots, steady_focus, trick_shots
4:51.911 trickshots L multishot Fluffy_Pillow 23.2/100: 23% focus precise_shots(2), steady_focus
4:53.099 trickshots G double_tap Fluffy_Pillow 10.7/100: 11% focus precise_shots, steady_focus, trick_shots, secrets_of_the_unblinking_vigil
4:54.289 trickshots J aimed_shot Fluffy_Pillow 17.8/100: 18% focus double_tap, precise_shots, trick_shots, secrets_of_the_unblinking_vigil
4:56.407 trickshots L multishot Fluffy_Pillow 30.4/100: 30% focus precise_shots(2), secrets_of_the_unblinking_vigil
4:57.679 trickshots K rapid_fire Fluffy_Pillow 17.9/100: 18% focus precise_shots, trick_shots
4:59.612 trickshots L multishot Fluffy_Pillow 36.3/100: 36% focus precise_shots
5:00.884 trickshots J aimed_shot Fluffy_Pillow 23.8/100: 24% focus trick_shots, secrets_of_the_unblinking_vigil
5:03.000 trickshots L multishot Fluffy_Pillow 36.4/100: 36% focus precise_shots, secrets_of_the_unblinking_vigil
5:04.271 trickshots M kill_shot Fluffy_Pillow 23.9/100: 24% focus trick_shots
5:05.543 trickshots O steady_shot Fluffy_Pillow 21.4/100: 21% focus trick_shots
5:07.026 trickshots F steady_shot Fluffy_Pillow 40.2/100: 40% focus trick_shots
5:08.511 trickshots J aimed_shot Fluffy_Pillow 59.0/100: 59% focus steady_focus, trick_shots
5:10.490 trickshots L multishot Fluffy_Pillow 36.5/100: 36% focus precise_shots(2), steady_focus
5:11.680 trickshots O steady_shot Fluffy_Pillow 24.0/100: 24% focus precise_shots, steady_focus, trick_shots
5:13.066 trickshots J aimed_shot Fluffy_Pillow 42.8/100: 43% focus precise_shots, steady_focus, trick_shots
5:15.044 trickshots L multishot Fluffy_Pillow 20.3/100: 20% focus precise_shots(2), steady_focus
5:16.232 trickshots O steady_shot Fluffy_Pillow 7.8/100: 8% focus precise_shots, steady_focus, trick_shots
5:17.617 trickshots K rapid_fire Fluffy_Pillow 26.6/100: 27% focus precise_shots, steady_focus, trick_shots
5:19.402 trickshots L multishot Fluffy_Pillow 44.9/100: 45% focus precise_shots, steady_focus
5:20.591 trickshots J aimed_shot Fluffy_Pillow 32.4/100: 32% focus steady_focus, trick_shots, secrets_of_the_unblinking_vigil
5:22.569 trickshots L multishot Fluffy_Pillow 44.9/100: 45% focus precise_shots(2), steady_focus, secrets_of_the_unblinking_vigil
5:23.759 trickshots M kill_shot Fluffy_Pillow 32.4/100: 32% focus precise_shots, trick_shots
5:25.031 trickshots O steady_shot Fluffy_Pillow 29.9/100: 30% focus precise_shots, trick_shots
5:26.514 cds E potion Fluffy_Pillow 48.7/100: 49% focus precise_shots, trick_shots
5:26.514 trickshots F steady_shot Fluffy_Pillow 48.7/100: 49% focus precise_shots, trick_shots, potion_of_spectral_agility
5:27.996 trickshots J aimed_shot Fluffy_Pillow 67.4/100: 67% focus precise_shots, steady_focus, trick_shots, potion_of_spectral_agility
5:29.975 trickshots L multishot Fluffy_Pillow 45.0/100: 45% focus precise_shots(2), steady_focus, potion_of_spectral_agility
5:31.164 trickshots O steady_shot Fluffy_Pillow 32.5/100: 32% focus precise_shots, steady_focus, trick_shots, potion_of_spectral_agility
5:32.551 trickshots O steady_shot Fluffy_Pillow 51.3/100: 51% focus precise_shots, steady_focus, trick_shots, potion_of_spectral_agility
5:33.939 trickshots L multishot Fluffy_Pillow 70.0/100: 70% focus precise_shots, steady_focus, trick_shots, potion_of_spectral_agility
5:35.127 trickshots J aimed_shot Fluffy_Pillow 57.6/100: 58% focus lock_and_load, steady_focus, trick_shots, potion_of_spectral_agility
5:36.315 trickshots L multishot Fluffy_Pillow 65.1/100: 65% focus precise_shots(2), steady_focus, potion_of_spectral_agility
5:37.503 trickshots K rapid_fire Fluffy_Pillow 52.6/100: 53% focus precise_shots, steady_focus, trick_shots, potion_of_spectral_agility
5:39.506 trickshots L multishot Fluffy_Pillow 72.3/100: 72% focus precise_shots, steady_focus, potion_of_spectral_agility
5:40.694 trickshots J aimed_shot Fluffy_Pillow 59.8/100: 60% focus steady_focus, trick_shots, secrets_of_the_unblinking_vigil, potion_of_spectral_agility
5:42.672 trickshots L multishot Fluffy_Pillow 72.3/100: 72% focus precise_shots(2), steady_focus, secrets_of_the_unblinking_vigil, potion_of_spectral_agility
5:43.861 trickshots J aimed_shot Fluffy_Pillow 59.8/100: 60% focus precise_shots, steady_focus, trick_shots, potion_of_spectral_agility
5:45.840 trickshots L multishot Fluffy_Pillow 37.4/100: 37% focus precise_shots(2), steady_focus, potion_of_spectral_agility
5:47.028 trickshots M kill_shot Fluffy_Pillow 24.9/100: 25% focus precise_shots, steady_focus, trick_shots, potion_of_spectral_agility
5:48.217 trickshots O steady_shot Fluffy_Pillow 22.4/100: 22% focus precise_shots, steady_focus, trick_shots, potion_of_spectral_agility
5:49.604 trickshots F steady_shot Fluffy_Pillow 40.9/100: 41% focus precise_shots, trick_shots, potion_of_spectral_agility
5:51.088 trickshots J aimed_shot Fluffy_Pillow 59.7/100: 60% focus precise_shots, steady_focus, trick_shots, potion_of_spectral_agility

Stats

Level Bonus (60) Race Bonus (orc) Raid-Buffed Unbuffed Gear Amount
Strength 274 3 295 277 0
Agility 450 -3 1411 1297 789 (677)
Stamina 414 1 1800 1715 1300
Intellect 369 -1 405 368 0
Spirit 0 0 0 0 0
Health 36000 34300 0
Focus 100 100 0
Spell Power 405 368 0
Crit 22.66% 22.66% 443
Haste 18.30% 18.30% 604
Versatility 3.65% 3.65% 146
Attack Power 1482 1297 0
Mastery 14.00% 14.00% 504
Armor 818 818 818
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 217.00
Local Head Helm of Insatiable Appetite
ilevel: 213, stats: { 103 Armor, +126 Sta, +92 Haste, +40 Mastery, +72 AgiInt }
Local Neck Noble's Birthstone Pendant
ilevel: 213, stats: { +71 Sta, +47 Crit, +147 Mastery }
Local Shoulders Boneshatter Pauldrons
ilevel: 235, stats: { 107 Armor, +124 Sta, +44 unknown(24), +44 unknown(25), +66 AgiInt }
item effects: { equip: Secrets of the Unblinking Vigil }
Local Chest Master Huntsman's Bandolier
ilevel: 213, stats: { 137 Armor, +126 Sta, +45 Crit, +86 Mastery, +72 AgiInt }, enchant: { +20 StrAgi }
Local Waist Load-Bearing Belt
ilevel: 213, stats: { 77 Armor, +95 Sta, +69 Haste, +30 Vers, +54 AgiInt }
Local Legs Greaves of Enigmatic Energies
ilevel: 213, stats: { 120 Armor, +126 Sta, +91 Crit, +41 Mastery, +72 AgiInt }
Local Feet Stoneclas Stompers
ilevel: 213, stats: { 86 Armor, +95 Sta, +69 Crit, +30 Mastery, +54 AgiInt }, enchant: { +15 Agi }
Local Wrists Bangles of Errant Pride
ilevel: 213, stats: { 69 Armor, +71 Sta, +48 Crit, +24 Mastery, +40 AgiInt }
Local Hands Oathsworn Soldier's Gauntlets
ilevel: 220, stats: { 80 Armor, +104 Sta, +67 Crit, +36 Haste, +58 AgiInt }
Local Finger1 Most Regal Signet of Sire Denathrius
ilevel: 220, stats: { +77 Sta, +161 Haste, +44 Mastery }, enchant: { +16 Crit }
item effects: { equip: Denathrius' Privilege }
Local Finger2 Ritualist's Treasured Ring
ilevel: 213, stats: { +71 Sta, +44 Crit, +149 Haste }, enchant: { +16 Crit }
Local Trinket1 Dreadfire Vessel
ilevel: 220, stats: { +73 StrAgiInt }, enchant: shadowcore_oil
item effects: { use: Dreadfire Vessel }
Local Trinket2 Stone Legion Heraldry
ilevel: 220, stats: { +73 StrAgi }
item effects: { equip: Stone Legionnaire }
Local Back Crest of the Legionnaire General
ilevel: 220, stats: { 39 Armor, +77 Sta, +52 Haste, +24 Vers, +43 StrAgiInt }
Local Main Hand Deadeye Blunderbuss
ilevel: 220, weapon: { 121 - 227, 3 }, stats: { +77 Agi, +137 Sta, +45 Haste, +92 Mastery }, enchant: sinful_revelation

Profile

hunter="secrets_ot_unblinking_vigil"
source=default
spec=marksmanship
level=60
race=orc
role=attack
position=ranged_back
talents=1101032
covenant=night_fae
soulbind=140:6//188:6

# Default consumables
potion=spectral_agility
flask=spectral_flask_of_power
food=feast_of_gluttonous_hedonism
augmentation=veiled

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask
actions.precombat+=/augmentation
actions.precombat+=/food
# Snapshot raid buffed stats before combat begins and pre-potting is done.
actions.precombat+=/snapshot_stats
actions.precombat+=/tar_trap,if=runeforge.soulforge_embers
actions.precombat+=/double_tap,precast_time=10,if=!covenant.kyrian&(!talent.volley|active_enemies<2)
actions.precombat+=/aimed_shot,if=active_enemies<3
actions.precombat+=/steady_shot,if=active_enemies>2

# Executed every time the actor is available.
actions=auto_shot
actions+=/counter_shot,line_cd=30,if=runeforge.sephuzs_proclamation|soulbind.niyas_tools_poison|(conduit.reversal_of_fortune&!runeforge.sephuzs_proclamation)
actions+=/use_items
actions+=/call_action_list,name=cds
actions+=/call_action_list,name=st,if=active_enemies<3
actions+=/call_action_list,name=trickshots,if=active_enemies>2

actions.cds=berserking,if=buff.trueshot.up|target.time_to_die<13
actions.cds+=/blood_fury,if=buff.trueshot.up|target.time_to_die<16
actions.cds+=/ancestral_call,if=buff.trueshot.up|target.time_to_die<16
actions.cds+=/fireblood,if=buff.trueshot.up|target.time_to_die<9
actions.cds+=/lights_judgment,if=buff.trueshot.down
actions.cds+=/bag_of_tricks,if=buff.trueshot.down
actions.cds+=/potion,if=buff.trueshot.up&buff.bloodlust.up|buff.trueshot.up&target.health.pct<20|target.time_to_die<26

actions.st=steady_shot,if=talent.steady_focus&(prev_gcd.1.steady_shot&buff.steady_focus.remains<5|buff.steady_focus.down)
actions.st+=/kill_shot
actions.st+=/double_tap,if=covenant.kyrian&cooldown.resonating_arrow.remains<gcd|!covenant.kyrian&(cooldown.aimed_shot.up|cooldown.rapid_fire.remains>cooldown.aimed_shot.remains)
actions.st+=/flare,if=tar_trap.up&runeforge.soulforge_embers
actions.st+=/tar_trap,if=runeforge.soulforge_embers&tar_trap.remains<gcd&cooldown.flare.remains<gcd
actions.st+=/explosive_shot
actions.st+=/wild_spirits
actions.st+=/flayed_shot
actions.st+=/death_chakram,if=focus+cast_regen<focus.max
actions.st+=/volley,if=buff.precise_shots.down|!talent.chimaera_shot|active_enemies<2
actions.st+=/a_murder_of_crows
actions.st+=/resonating_arrow
actions.st+=/trueshot,if=buff.precise_shots.down|buff.resonating_arrow.up|buff.wild_spirits.up|buff.volley.up&active_enemies>1
actions.st+=/aimed_shot,target_if=min:(dot.serpent_sting.remains<?action.serpent_sting.in_flight_to_target*dot.serpent_sting.duration),if=buff.precise_shots.down|(buff.trueshot.up|full_recharge_time<gcd+cast_time)&(!talent.chimaera_shot|active_enemies<2)|buff.trick_shots.remains>execute_time&active_enemies>1
actions.st+=/rapid_fire,if=focus+cast_regen<focus.max&(buff.trueshot.down|!runeforge.eagletalons_true_focus)&(buff.double_tap.down|talent.streamline)
actions.st+=/chimaera_shot,if=buff.precise_shots.up|focus>cost+action.aimed_shot.cost
actions.st+=/arcane_shot,if=buff.precise_shots.up|focus>cost+action.aimed_shot.cost
actions.st+=/serpent_sting,target_if=min:remains,if=refreshable&target.time_to_die>duration
actions.st+=/barrage,if=active_enemies>1
actions.st+=/rapid_fire,if=focus+cast_regen<focus.max&(buff.double_tap.down|talent.streamline)
actions.st+=/steady_shot

actions.trickshots=steady_shot,if=talent.steady_focus&in_flight&buff.steady_focus.remains<5
actions.trickshots+=/double_tap,if=covenant.kyrian&cooldown.resonating_arrow.remains<gcd|cooldown.rapid_fire.remains<cooldown.aimed_shot.full_recharge_time|!(talent.streamline&runeforge.surging_shots)|!covenant.kyrian
actions.trickshots+=/tar_trap,if=runeforge.soulforge_embers&tar_trap.remains<gcd&cooldown.flare.remains<gcd
actions.trickshots+=/flare,if=tar_trap.up&runeforge.soulforge_embers
actions.trickshots+=/explosive_shot
actions.trickshots+=/wild_spirits
actions.trickshots+=/resonating_arrow
actions.trickshots+=/volley
actions.trickshots+=/barrage
actions.trickshots+=/trueshot
actions.trickshots+=/rapid_fire,if=buff.trick_shots.remains>=execute_time&runeforge.surging_shots&buff.double_tap.down
actions.trickshots+=/aimed_shot,target_if=min:(dot.serpent_sting.remains<?action.serpent_sting.in_flight_to_target*dot.serpent_sting.duration),if=buff.trick_shots.remains>=execute_time&(buff.precise_shots.down|full_recharge_time<cast_time+gcd|buff.trueshot.up)
actions.trickshots+=/death_chakram,if=focus+cast_regen<focus.max
actions.trickshots+=/rapid_fire,if=buff.trick_shots.remains>=execute_time
actions.trickshots+=/multishot,if=buff.trick_shots.down|buff.precise_shots.up&focus>cost+action.aimed_shot.cost&(!talent.chimaera_shot|active_enemies>3)
actions.trickshots+=/chimaera_shot,if=buff.precise_shots.up&focus>cost+action.aimed_shot.cost&active_enemies<4
actions.trickshots+=/kill_shot,if=buff.dead_eye.down
actions.trickshots+=/a_murder_of_crows
actions.trickshots+=/flayed_shot
actions.trickshots+=/serpent_sting,target_if=min:dot.serpent_sting.remains,if=refreshable
actions.trickshots+=/multishot,if=focus>cost+action.aimed_shot.cost
actions.trickshots+=/steady_shot

head=helm_of_insatiable_appetite,id=183001,bonus_id=7188/1485,ilevel=213
neck=nobles_birthstone_pendant,id=183039,bonus_id=7188/1485,ilevel=213
shoulders=boneshatter_pauldrons,id=172327,bonus_id=7014,ilevel=235
back=crest_of_the_legionnaire_general,id=183032,bonus_id=6805,ilevel=220
chest=master_huntsmans_bandolier,id=182988,bonus_id=6805,ilevel=213,enchant=eternal_skirmish
wrists=bangles_of_errant_pride,id=182977,bonus_id=6805,ilevel=213
hands=oathsworn_soldiers_gauntlets,id=182991,bonus_id=6805,ilevel=220
waist=loadbearing_belt,id=183016,bonus_id=6805,ilevel=213
legs=greaves_of_enigmatic_energies,id=183012,bonus_id=6805,ilevel=213
feet=stoneclas_stompers,id=183006,bonus_id=6805,ilevel=213,enchant=15agility
finger1=most_regal_signet_of_sire_denathrius,id=183036,bonus_id=6805,ilevel=220,enchant=16crit
finger2=ritualists_treasured_ring,id=183037,bonus_id=6805,ilevel=213,enchant=16crit
trinket1=dreadfire_vessel,id=184030,bonus_id=6805,ilevel=220,enchant=shadowcore_oil
trinket2=stone_legion_heraldry,id=184027,bonus_id=6805,ilevel=220
main_hand=deadeye_blunderbuss,id=184250,bonus_id=6805,ilevel=220,enchant=sinful_revelation

# Gear Summary
# gear_ilvl=217.27
# gear_agility=789
# gear_stamina=1300
# gear_crit_rating=443
# gear_haste_rating=604
# gear_mastery_rating=504
# gear_versatility_rating=54
# gear_armor=818

serpentstalkers_trickery : 12001 dps, 3502 dps to main target

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
12000.6 12000.6 22.5 / 0.187% 1518.1 / 12.6% 1182.8
RPS Out RPS In Primary Resource Waiting APM Active Skill
10.1 9.9 Focus 0.00% 47.4 100.0% 100%
Talents
Night Fae
Runeforge

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
serpentstalkers_trickery 12001
Aimed Shot 3682 (4049) 30.7% (33.7%) 47.6 6.26sec 25460 16464 Direct 237.7 (260.7) 3775 7571 4639 22.7% (22.7%)

Stats Details: Aimed Shot

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 47.60 237.67 0.00 0.00 1.5464 0.0000 1102477.97 1574779.53 29.99% 16463.69 16463.69
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 77.25% 183.60 123 248 3775.19 2524 9967 3777.98 3566 4038 693163 990114 29.99%
crit 22.75% 54.07 24 85 7570.56 5048 19934 7576.94 6319 8939 409315 584666 29.99%

Action Details: Aimed Shot

  • id:19434
  • school:physical
  • range:40.0
  • travel_speed:100.0000
  • radius:8.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:12.000
  • cooldown hasted:true
  • base_recharge_multiplier:1.000
  • base_execute_time:2.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:focus
  • base_cost:35.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:19434
  • name:Aimed Shot
  • school:physical
  • tooltip:
  • description:A powerful aimed shot that deals {$s1=0} Physical damage.

Action Priority List

    trickshots
    [J]:47.77
  • if_expr:buff.trick_shots.remains>=execute_time&(buff.precise_shots.down|full_recharge_time<cast_time+gcd|buff.trueshot.up)
  • target_if_expr:(dot.serpent_sting.remains<?action.serpent_sting.in_flight_to_target*dot.serpent_sting.duration)
    Aimed Shot (_double_tap) 367 3.0% 0.0 0.00sec 0 0 Direct 23.0 3872 7791 4755 22.6%

Stats Details: Aimed Shot Double Tap

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 0.00 23.00 0.00 0.00 0.0000 0.0000 109381.01 156239.83 29.99% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 77.43% 17.81 3 29 3871.53 2524 9967 3908.92 3063 6457 68947 98484 29.99%
crit 22.57% 5.19 0 13 7790.78 5048 19934 7813.08 0 19934 40434 57756 29.79%

Action Details: Aimed Shot Double Tap

  • id:19434
  • school:physical
  • range:40.0
  • travel_speed:100.0000
  • radius:8.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:12.000
  • cooldown hasted:true
  • base_recharge_multiplier:1.000
  • base_execute_time:2.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:focus
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:19434
  • name:Aimed Shot
  • school:physical
  • tooltip:
  • description:A powerful aimed shot that deals {$s1=0} Physical damage.
Auto Shot 373 3.1% 112.7 2.68sec 992 437 Direct 112.4 811 1621 994 22.6%

Stats Details: Auto Shot

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 112.66 112.44 0.00 0.00 2.2685 0.0000 111781.55 159668.77 29.99% 437.39 437.39
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 77.36% 86.99 59 113 810.68 774 1019 810.64 795 829 70518 100729 29.99%
crit 22.64% 25.45 10 41 1620.97 1548 2037 1620.79 1562 1689 41263 58940 29.99%

Action Details: Auto Shot

  • id:75
  • school:physical
  • range:40.0
  • travel_speed:60.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00

Spelldata

  • id:75
  • name:Auto Shot
  • school:physical
  • tooltip:Firing at the target.
  • description:Automatically shoots the target until cancelled.
Dreadfire Vessel 136 1.1% 3.7 90.78sec 10930 0 Direct 3.7 9042 18062 10967 21.3%

Stats Details: Dreadfire Vessel

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 3.73 3.72 0.00 0.00 0.0000 0.0000 40784.31 40784.31 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 78.68% 2.93 0 4 9041.57 8937 9474 9011.02 0 9474 26464 26464 0.00%
crit 21.32% 0.79 0 3 18061.79 17875 18947 10494.64 0 18947 14321 14321 0.00%

Action Details: Dreadfire Vessel

  • id:344732
  • school:fire
  • range:50.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:90.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:8212.26
  • base_dd_max:8212.26
  • base_dd_mult:1.00

Spelldata

  • id:344732
  • name:Dreadfire Vessel
  • school:fire
  • tooltip:
  • description:Unleash incendiary flames at your target inflicting {$s1=0} Fire damage.
Eternal Skirmish 40 0.3% 22.0 13.41sec 547 0 Direct 22.0 446 892 547 22.7%

Stats Details: Eternal Skirmish

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 21.96 21.96 0.00 0.00 0.0000 0.0000 12015.12 12015.12 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 77.26% 16.96 6 31 445.77 435 485 445.82 435 459 7562 7562 0.00%
crit 22.74% 4.99 0 14 891.99 871 969 887.50 0 969 4453 4453 0.00%

Action Details: Eternal Skirmish

  • id:323889
  • school:shadow
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:400.00
  • base_dd_max:400.00
  • base_dd_mult:1.00

Spelldata

  • id:323889
  • name:Eternal Skirmish
  • school:shadow
  • tooltip:
  • description:Deals {$s1=400} Shadow damage.
Kill Shot 83 0.7% 4.6 13.43sec 5429 4546 Direct 4.6 4254 9559 5459 22.8%

Stats Details: Kill Shot

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 4.61 4.58 0.00 0.00 1.1944 0.0000 25035.65 35760.92 29.99% 4546.15 4546.15
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 77.23% 3.54 0 7 4253.80 4065 4838 4245.84 0 4838 15060 21512 29.97%
crit 22.77% 1.04 0 5 9558.51 9146 10885 6668.04 0 10885 9976 14249 20.92%

Action Details: Kill Shot

  • id:53351
  • school:physical
  • range:40.0
  • travel_speed:80.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:10.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:focus
  • base_cost:10.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:53351
  • name:Kill Shot
  • school:physical
  • tooltip:
  • description:You attempt to finish off a wounded target, dealing {$s1=0} Physical damage. Only usable on enemies with less than {$s2=20}% health.

Action Priority List

    trickshots
    [M]:4.61
  • if_expr:buff.dead_eye.down
Master Marksman 489 4.1% 313.9 0.97sec 467 0 Periodic 530.1 276 0 276 0.0% 70.7%

Stats Details: Master Marksman

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 313.91 0.00 530.13 530.13 0.0000 2.0000 146601.35 146601.35 0.00% 138.27 0.00
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 100.00% 530.13 396 688 276.49 37 2115 276.80 227 322 146601 146601 0.00%

Action Details: Master Marksman

  • id:269576
  • school:physical
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:false
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:6.00
  • base_tick_time:2.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH

Spelldata

  • id:269576
  • name:Master Marksman
  • school:physical
  • tooltip:Bleeding for $w1 damage every $t1 sec.
  • description:{$@spelldesc260309=Your ranged special attack critical strikes cause the target to bleed for an additional {$s1=15}% of the damage dealt over {$269576d=6 seconds}.}
Multi-Shot 2694 22.5% 81.5 3.67sec 9907 8685 Direct 406.5 1620 3239 1986 22.6%

Stats Details: Multishot

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 81.50 406.49 0.00 0.00 1.1407 0.0000 807414.42 1153310.76 29.99% 8685.42 8685.42
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 77.38% 314.55 235 396 1619.80 953 2194 1619.92 1497 1713 509632 727959 29.99%
crit 22.62% 91.93 56 135 3238.75 1905 4389 3238.73 2925 3489 297782 425352 29.99%

Action Details: Multishot

  • id:257620
  • school:physical
  • range:40.0
  • travel_speed:50.0000
  • radius:10.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:5
  • harmful:true

Resources

  • resource:focus
  • base_cost:20.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:257620
  • name:Multi-Shot
  • school:physical
  • tooltip:
  • description:Fires several missiles, hitting your current target and up to $I enemies within $A1 yards for {$s1=0} Physical damage.

Action Priority List

    trickshots
    [L]:74.07
  • if_expr:buff.trick_shots.down|buff.precise_shots.up&focus>cost+action.aimed_shot.cost&(!talent.chimaera_shot|active_enemies>3)
    trickshots
    [N]:7.43
  • if_expr:focus>cost+action.aimed_shot.cost
Rapid Fire 1092 9.1% 16.4 18.31sec 19996 11390 Periodic 602.2 444 887 544 22.6% 1.6%

Stats Details: Rapid Fire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 16.37 0.00 120.82 602.18 1.7556 0.2039 327322.29 467547.15 29.99% 11389.88 11389.88
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 77.44% 466.35 300 676 443.60 351 925 443.61 428 460 206868 295490 29.99%
crit 22.56% 135.83 81 199 886.70 703 1850 886.81 809 967 120455 172057 29.99%

Action Details: Rapid Fire

  • id:257044
  • school:physical
  • range:40.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:20.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:false
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:2.00
  • base_tick_time:0.33
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH

Spelldata

  • id:257044
  • name:Rapid Fire
  • school:physical
  • tooltip:Being targeted by Rapid Fire.
  • description:Shoot a stream of {$s1=7} shots at your target over {$d=2 seconds}, dealing a total of ${$m1*$257045sw1} Physical damage. {$?s321281=true}[ Each shot generates {$263585s1=1} Focus.][] Usable while moving.

Action Details: Rapid Fire Damage

  • id:257045
  • school:physical
  • range:40.0
  • travel_speed:40.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:on_hit
  • energize_resource:focus
  • energize_amount:1.0

Spelldata

  • id:257045
  • name:Rapid Fire
  • school:physical
  • tooltip:
  • description:{$@spelldesc257044=Shoot a stream of {$s1=7} shots at your target over {$d=2 seconds}, dealing a total of ${$m1*$257045sw1} Physical damage. {$?s321281=true}[ Each shot generates {$263585s1=1} Focus.][] Usable while moving.}

Action Priority List

    trickshots
    [K]:16.37
  • if_expr:buff.trick_shots.remains>=execute_time
Serpent Sting 847 7.1% 0.0 0.00sec 0 0 Direct 47.5 507 1014 620 22.4%
Periodic 384.4 476 953 584 22.6% 55.2%

Stats Details: Serpent Sting

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 0.00 47.46 384.44 384.44 0.0000 2.1541 253844.52 253844.52 0.00% 306.53 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 77.62% 36.84 23 52 506.64 479 630 506.71 495 519 18662 18662 0.00%
crit 22.38% 10.62 2 22 1014.02 958 1261 1014.17 958 1175 10772 10772 0.00%
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 77.41% 297.59 215 396 475.95 3 630 476.01 466 484 141642 141642 0.00%
crit 22.59% 86.85 49 129 953.03 7 1261 953.08 898 998 82767 82767 0.00%

Action Details: Serpent Sting

  • id:271788
  • school:nature
  • range:40.0
  • travel_speed:45.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:focus
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.165000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:18.00
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH

Spelldata

  • id:271788
  • name:Serpent Sting
  • school:nature
  • tooltip:Suffering {$s2=0} Nature damage every $t2 sec.
  • description:Fire a shot that poisons your target, causing them to take {$s1=0} Nature damage instantly and an additional $o2 Nature damage over {$d=18 seconds}.
Shadowcore Oil Blast 44 0.4% 43.8 6.81sec 300 0 Direct 43.8 244 488 300 22.9%

Stats Details: Shadowcore Oil Blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 43.84 43.84 0.00 0.00 0.0000 0.0000 13160.09 13160.09 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 77.06% 33.78 18 53 244.16 239 266 244.18 241 248 8248 8248 0.00%
crit 22.94% 10.06 2 20 488.37 479 533 488.36 479 513 4912 4912 0.00%

Action Details: Shadowcore Oil Blast

  • id:336463
  • school:shadow
  • range:60.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:220.00
  • base_dd_max:220.00
  • base_dd_mult:1.00

Spelldata

  • id:336463
  • name:Shadowcore Oil Blast
  • school:shadow
  • tooltip:
  • description:Deals {$s1=220} Shadow damage.
Steady Shot 348 2.9% 66.5 4.50sec 1570 1165 Direct 67.4 1264 2527 1550 22.6%

Stats Details: Steady Shot

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 66.53 67.42 0.00 0.00 1.3476 0.0000 104477.32 149235.40 29.99% 1165.33 1165.33
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 77.38% 52.17 34 75 1264.01 1219 1605 1263.71 1238 1289 65943 94192 29.99%
crit 22.62% 15.25 3 28 2527.10 2439 3210 2526.48 2439 2696 38535 55043 29.99%

Action Details: Steady Shot

  • id:56641
  • school:physical
  • range:40.0
  • travel_speed:75.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:1.75
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:on_cast
  • energize_resource:focus
  • energize_amount:10.0

Spelldata

  • id:56641
  • name:Steady Shot
  • school:physical
  • tooltip:
  • description:A steady shot that causes {$s1=0} Physical damage. Usable while moving.{$?s321018=true}[ |cFFFFFFFFGenerates {$s2=0} Focus.][]

Action Priority List

    trickshots
    [F]:16.14
  • if_expr:talent.steady_focus&in_flight&buff.steady_focus.remains<5
    trickshots
    [O]:50.66
Wild Spirits 50 (1804) 0.4% (15.0%) 3.0 120.69sec 180433 164205 Direct 14.8 (298.0) 807 1616 990 22.6% (22.6%)

Stats Details: Wild Spirits

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.98 14.84 0.00 0.00 1.0991 0.0000 14689.57 14689.57 0.00% 164205.30 164205.30
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 77.40% 11.48 4 15 807.32 776 910 807.40 783 838 9270 9270 0.00%
crit 22.60% 3.35 0 9 1616.05 1552 1820 1580.54 0 1768 5420 5420 0.00%

Action Details: Wild Spirits

  • id:328231
  • school:nature
  • range:40.0
  • travel_speed:30.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:120.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:328231
  • name:Wild Spirits
  • school:nature
  • tooltip:
  • description:Evoke the energy of Wild Spirits at the target location, dealing {$328837s3=0} Nature damage and apply Hunter's Mark to all enemy targets within the area for {$328837d=15 seconds}. While the Wild Spirits are active, each damaging ability you or your pet use against a target in the area will strike up to $328757I nearby targets for {$328757s1=0} Nature damage.

Action Details: Wild Spirits Damage

  • id:328837
  • school:nature
  • range:100.0
  • travel_speed:0.0000
  • radius:12.0
  • trigger_gcd:0.0000
  • gcd_type:attack_haste
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:328837
  • name:Wild Spirits
  • school:nature
  • tooltip:
  • description:{$@spelldesc328231=Evoke the energy of Wild Spirits at the target location, dealing {$328837s3=0} Nature damage and apply Hunter's Mark to all enemy targets within the area for {$328837d=15 seconds}. While the Wild Spirits are active, each damaging ability you or your pet use against a target in the area will strike up to $328757I nearby targets for {$328757s1=0} Nature damage.}

Action Priority List

    trickshots
    [H]:2.98
    Wild Spirits (_proc) 1755 14.6% 56.6 4.52sec 9229 0 Direct 283.2 1505 3010 1846 22.6%

Stats Details: Wild Spirits Proc

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 56.64 283.21 0.00 0.00 0.0000 0.0000 522754.39 522754.39 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 77.37% 219.11 136 254 1505.32 1355 1699 1505.91 1487 1546 329830 329830 0.00%
crit 22.63% 64.10 31 91 3009.78 2711 3398 3010.99 2938 3125 192925 192925 0.00%

Action Details: Wild Spirits Proc

  • id:328757
  • school:nature
  • range:40.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:attack_haste
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:5
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:328757
  • name:Wild Spirits
  • school:nature
  • tooltip:
  • description:{$@spelldesc328231=Evoke the energy of Wild Spirits at the target location, dealing {$328837s3=0} Nature damage and apply Hunter's Mark to all enemy targets within the area for {$328837d=15 seconds}. While the Wild Spirits are active, each damaging ability you or your pet use against a target in the area will strike up to $328757I nearby targets for {$328757s1=0} Nature damage.}
Simple Action Stats Execute Interval
serpentstalkers_trickery
Veiled Augmentation (augmentation) 1.0 0.00sec

Stats Details: Augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Augmentation

  • id:347901
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:serpentstalkers_trickery
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Blood Fury 3.0 120.81sec

Stats Details: Blood Fury

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.97 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Blood Fury

  • id:20572
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:120.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:20572
  • name:Blood Fury
  • school:physical
  • tooltip:Attack power increased by $w1.
  • description:Increases your attack power by {$s1=122} for {$d=15 seconds}.

Action Priority List

    cds
    [D]:2.97
  • if_expr:buff.trueshot.up|target.time_to_die<16
Double Tap 5.6 60.59sec

Stats Details: Double Tap

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 5.60 0.00 0.00 0.00 0.9767 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Double Tap

  • id:260402
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:60.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:260402
  • name:Double Tap
  • school:physical
  • tooltip:Your next Aimed Shot will fire a second time instantly at {$s4=100}% power and consume no Focus, or your next Rapid Fire will shoot {$s3=100}% additional shots during its channel.
  • description:Your next Aimed Shot will fire a second time instantly at {$s4=100}% power without consuming Focus, or your next Rapid Fire will shoot {$s3=100}% additional shots during its channel.

Action Priority List

    trickshots
    [G]:4.60
  • if_expr:covenant.kyrian&cooldown.resonating_arrow.remains<gcd|cooldown.rapid_fire.remains<cooldown.aimed_shot.full_recharge_time|!(talent.streamline&runeforge.surging_shots)|!covenant.kyrian
Spectral Flask of Power (flask) 1.0 0.00sec

Stats Details: Flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Flask

  • id:307185
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:serpentstalkers_trickery
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Feast of Gluttonous Hedonism (food) 1.0 0.00sec

Stats Details: Food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Food

  • id:308462
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:serpentstalkers_trickery
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Potion of Spectral Agility (potion) 1.5 309.75sec

Stats Details: Potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.48 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Potion

  • id:307159
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:300.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Action Priority List

    cds
    [E]:1.47
  • if_expr:buff.trueshot.up&buff.bloodlust.up|buff.trueshot.up&target.health.pct<20|target.time_to_die<26
Trueshot 3.0 120.83sec

Stats Details: Trueshot

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.97 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Trueshot

  • id:288613
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:attack_haste
  • min_gcd:0.0000
  • cooldown:120.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:288613
  • name:Trueshot
  • school:physical
  • tooltip:The cooldown of Aimed Shot and Rapid Fire is reduced by ${$m1/4}%, and Aimed Shot casts {$s4=50}% faster. All Focus generation is increased by {$s5=50}%.
  • description:Reduces the cooldown of your Aimed Shot and Rapid Fire by ${$m1/4}%, and causes Aimed Shot to cast {$s4=50}% faster for {$d=15 seconds}. While Trueshot is active, you generate {$s5=50}% additional Focus.

Action Priority List

    trickshots
    [I]:2.97

Buffs

Dynamic Buffs Start Refresh Interval Trigger Avg Dur Up-Time Benefit Overflow Expiry
Blood Fury 3.0 0.0 120.8sec 120.8sec 14.7sec 14.64% 0.00% 0.0 (0.0) 2.8

Buff Details

  • buff initial source:serpentstalkers_trickery
  • cooldown name:buff_blood_fury
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:120.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:attack_power
  • amount:122.00

Trigger Details

  • interval_min/max:120.0s / 122.9s
  • trigger_min/max:120.0s / 122.9s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 15.0s

Stack Uptimes

  • blood_fury_1:14.64%

Spelldata

  • id:20572
  • name:Blood Fury
  • tooltip:Attack power increased by $w1.
  • description:Increases your attack power by {$s1=122} for {$d=15 seconds}.
  • max_stacks:0
  • duration:15.00
  • cooldown:120.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 40.0sec 13.52% 0.00% 0.0 (0.0) 1.0

Buff Details

  • buff initial source:serpentstalkers_trickery
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • base duration:40.00
  • duration modifier:1.00
  • base cooldown:300.00
  • default_chance:100.00%
  • default_value:0.30
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:40.0s / 40.0s

Stack Uptimes

  • bloodlust_1:13.52%

Spelldata

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by $w1%.
  • description:Increases haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Double Tap 5.6 0.0 58.4sec 60.6sec 4.5sec 8.39% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:serpentstalkers_trickery
  • cooldown name:buff_double_tap
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.50
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:50.0s / 62.7s
  • trigger_min/max:60.0s / 62.7s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 11.2s

Stack Uptimes

  • double_tap_1:8.39%

Spelldata

  • id:260402
  • name:Double Tap
  • tooltip:Your next Aimed Shot will fire a second time instantly at {$s4=100}% power and consume no Focus, or your next Rapid Fire will shoot {$s3=100}% additional shots during its channel.
  • description:Your next Aimed Shot will fire a second time instantly at {$s4=100}% power without consuming Focus, or your next Rapid Fire will shoot {$s3=100}% additional shots during its channel.
  • max_stacks:0
  • duration:15.00
  • cooldown:60.00
  • default_chance:0.00%
Well Fed (feast_of_gluttonous_hedonism) 1.0 0.0 0.0sec 0.0sec 300.0sec 100.00% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:serpentstalkers_trickery
  • cooldown name:buff_feast_of_gluttonous_hedonism
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:agility
  • amount:20.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:240.1s / 359.8s

Stack Uptimes

  • feast_of_gluttonous_hedonism_1:100.00%

Spelldata

  • id:327709
  • name:Well Fed
  • tooltip:Agility increased by $w1.
  • description:Agility increased by {$s1=20}. Lasts {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Lock and Load 8.8 0.2 30.6sec 30.0sec 1.8sec 5.37% 18.07% 0.2 (0.2) 0.0

Buff Details

  • buff initial source:serpentstalkers_trickery
  • cooldown name:buff_lock_and_load
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:8.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:1.8s / 303.7s
  • trigger_min/max:1.8s / 303.7s
  • trigger_pct:7.97%
  • duration_min/max:0.0s / 11.2s

Stack Uptimes

  • lock_and_load_1:5.37%

Spelldata

  • id:194594
  • name:Lock and Load
  • tooltip:Aimed Shot costs no Focus and is instant.
  • description:{$@spelldesc194595=Your ranged auto attacks have a {$194595h=8}% chance to trigger Lock and Load, causing your next Aimed Shot to cost no Focus and be instant.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%

Trigger Spelldata

  • id:194595
  • name:Lock and Load
  • tooltip:
  • description:Your ranged auto attacks have a {$194595h=8}% chance to trigger Lock and Load, causing your next Aimed Shot to cost no Focus and be instant.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:8.00%
Potion of Spectral Agility 1.5 0.0 309.3sec 309.3sec 23.3sec 11.25% 0.00% 0.0 (0.0) 1.2

Buff Details

  • buff initial source:serpentstalkers_trickery
  • cooldown name:buff_potion_of_spectral_agility
  • max_stacks:1
  • base duration:25.00
  • duration modifier:1.00
  • base cooldown:1.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:agility
  • amount:190.00

Trigger Details

  • interval_min/max:300.0s / 332.9s
  • trigger_min/max:300.0s / 332.9s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 25.0s

Stack Uptimes

  • potion_of_spectral_agility_1:11.25%

Spelldata

  • id:307159
  • name:Potion of Spectral Agility
  • tooltip:Agility increased by $w1.
  • description:Increases your Agility by {$s1=190} for {$d=25 seconds}.
  • max_stacks:0
  • duration:25.00
  • cooldown:1.00
  • default_chance:0.00%
Precise Shots 40.1 7.5 7.5sec 6.3sec 2.9sec 38.80% 82.48% 3.8 (3.8) 0.0

Buff Details

  • buff initial source:serpentstalkers_trickery
  • cooldown name:buff_precise_shots
  • max_stacks:2
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.50
  • default_chance:101.00%
  • default_value:0.75
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.9s / 35.2s
  • trigger_min/max:0.9s / 14.3s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 29.3s

Stack Uptimes

  • precise_shots_1:33.42%
  • precise_shots_2:5.38%

Spelldata

  • id:260242
  • name:Precise Shots
  • tooltip:Damage of {$?s342049=false}[Chimaera Shot][Arcane Shot] or Multi-Shot increased by {$s1=75}%.
  • description:{$@spelldesc260240=Aimed Shot causes your next 1-{$260242u=2} {$?s342049=false}[Chimaera Shots][Arcane Shots] or Multi-Shots to deal {$260242s1=75}% more damage.}
  • max_stacks:2
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
Spectral Flask of Power 1.0 0.0 0.0sec 0.0sec 300.0sec 100.00% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:serpentstalkers_trickery
  • cooldown name:buff_spectral_flask_of_power
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:agility
  • amount:70.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:240.1s / 359.8s

Stack Uptimes

  • spectral_flask_of_power_1:100.00%

Spelldata

  • id:307185
  • name:Spectral Flask of Power
  • tooltip:$pri increased by $w1.
  • description:Increases $pri by {$s1=70} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Steady Focus 6.2 18.7 51.8sec 12.2sec 45.6sec 94.40% 0.00% 18.7 (18.7) 5.3

Buff Details

  • buff initial source:serpentstalkers_trickery
  • cooldown name:buff_steady_focus
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.07
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:15.0s / 287.8s
  • trigger_min/max:4.0s / 40.8s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 284.2s

Stack Uptimes

  • steady_focus_1:94.40%

Spelldata

  • id:193534
  • name:Steady Focus
  • tooltip:Haste increased by {$s1=7}%.
  • description:{$@spelldesc193533=Using Steady Shot twice in a row increases your Haste by {$193534s1=7}% for {$193534d=15 seconds}.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%

Trigger Spelldata

  • id:193533
  • name:Steady Focus
  • tooltip:
  • description:Using Steady Shot twice in a row increases your Haste by {$193534s1=7}% for {$193534d=15 seconds}.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
Trick Shots 64.8 16.7 4.6sec 3.7sec 4.1sec 88.81% 100.00% 16.7 (16.7) 0.0

Buff Details

  • buff initial source:serpentstalkers_trickery
  • cooldown name:buff_trick_shots
  • max_stacks:1
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:1.8s / 12.3s
  • trigger_min/max:0.9s / 11.2s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 12.3s

Stack Uptimes

  • trick_shots_1:88.81%

Spelldata

  • id:257622
  • name:Trick Shots
  • tooltip:Your next Aimed Shot or Rapid Fire will ricochet and hit {$257621s1=5} additional targets for {$257621s4=50}% of normal damage.
  • description:{$@spelldesc257621=When Multi-Shot hits {$s2=3} or more targets, your next Aimed Shot or Rapid Fire will ricochet and hit up to {$s1=5} additional targets for {$s4=50}% of normal damage.}
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
Trueshot 3.0 0.0 120.8sec 120.8sec 19.1sec 18.98% 0.00% 0.0 (0.0) 2.8

Buff Details

  • buff initial source:serpentstalkers_trickery
  • cooldown name:buff_trueshot
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.31
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.50
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:120.0s / 122.9s
  • trigger_min/max:120.0s / 122.9s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 19.7s

Stack Uptimes

  • trueshot_1:18.98%

Spelldata

  • id:288613
  • name:Trueshot
  • tooltip:The cooldown of Aimed Shot and Rapid Fire is reduced by ${$m1/4}%, and Aimed Shot casts {$s4=50}% faster. All Focus generation is increased by {$s5=50}%.
  • description:Reduces the cooldown of your Aimed Shot and Rapid Fire by ${$m1/4}%, and causes Aimed Shot to cast {$s4=50}% faster for {$d=15 seconds}. While Trueshot is active, you generate {$s5=50}% additional Focus.
  • max_stacks:0
  • duration:15.00
  • cooldown:120.00
  • default_chance:0.00%
Veiled Augmentation 1.0 0.0 0.0sec 0.0sec 300.0sec 100.00% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:serpentstalkers_trickery
  • cooldown name:buff_veiled_augmentation
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:agility
  • amount:18.00
  • stat:strength
  • amount:18.00
  • stat:intellect
  • amount:18.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:240.1s / 359.8s

Stack Uptimes

  • veiled_augmentation_1:100.00%

Spelldata

  • id:347901
  • name:Veiled Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=18} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Wild Spirits 3.0 0.0 120.7sec 120.7sec 17.5sec 17.43% 0.00% 0.0 (0.0) 2.8

Buff Details

  • buff initial source:serpentstalkers_trickery
  • cooldown name:buff_wild_spirits
  • max_stacks:1
  • base duration:18.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:120.0s / 122.7s
  • trigger_min/max:120.0s / 122.7s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 18.0s

Stack Uptimes

  • wild_spirits_1:17.43%

Spelldata

  • id:328837
  • name:Wild Spirits
  • tooltip:
  • description:{$@spelldesc328231=Evoke the energy of Wild Spirits at the target location, dealing {$328837s3=0} Nature damage and apply Hunter's Mark to all enemy targets within the area for {$328837d=15 seconds}. While the Wild Spirits are active, each damaging ability you or your pet use against a target in the area will strike up to $328757I nearby targets for {$328757s1=0} Nature damage.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
Windfury Totem 1.0 0.0 0.0sec 0.0sec 300.0sec 100.00% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:serpentstalkers_trickery
  • cooldown name:buff_windfury_totem
  • max_stacks:1
  • base duration:900.00
  • duration modifier:1.00
  • base cooldown:0.50
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:240.1s / 359.8s

Stack Uptimes

  • windfury_totem_1:100.00%

Spelldata

  • id:327942
  • name:Windfury Totem
  • tooltip:Your auto-attacks have a {$h=10}% chance to instantly attack again.
  • description:{$@spelldesc8512=Summons a Windfury Totem with {$s1=5} health at the feet of the caster for {$d=120 seconds}. Party members within {$s2=30} yds have a {$327942h=10}% chance when they auto-attack to swing an extra time.}
  • max_stacks:0
  • duration:120.00
  • cooldown:0.00
  • default_chance:10.00%
Constant Buffs
Arcane Intellect

Buff Details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff Details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:15.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
Power Word: Fortitude

Buff Details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.$?$w2>0[ Magic damage taken reduced by $w2%.][]
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Procs, Uptimes & Benefits

Proc Count Min Max Interval Min Max
double_tap_aimed 4.6 1.0 7.0 68.9s 47.1s 350.8s
double_tap_rapid_fire 0.9 0.0 5.0 92.4s 55.0s 246.1s
Uptime Avg % Min Max Avg Dur Min Max
Focus Cap 0.87% 0.68% 1.43% 0.9s 0.0s 2.4s

Cooldown waste details

Seconds per ExecuteSeconds per Iteration
AbilityAverageMinimumMaximumAverageMinimumMaximum
Double Tap0.7370.0012.6932.7600.1397.165
Aimed Shot1.2840.0016.87813.6234.17627.782
Kill Shot3.7310.00119.81212.4040.02326.708
Wild Spirits0.7890.0012.7071.3260.0004.115
Trueshot0.8550.0012.9371.5960.2714.384
Rapid Fire3.1140.00134.23941.90417.74071.939

Resources

Gains Type Count Total Tot% Avg Overflow Ovr%
serpentstalkers_trickery
steady_shot Focus 67.53 655.29 22.04% 9.70 20.02 2.96%
rapid_fire Focus 120.83 120.67 4.06% 1.00 0.15 0.13%
focus_regen Focus 643.17 1945.27 65.43% 3.02 19.30 0.98%
Trueshot Focus 207.81 251.62 8.46% 1.21 0.87 0.34%
Change Start Gain/s Loss/s Overflow (Total) End (Avg) Min Max
Focus 100.0 9.91 10.12 40.3 36.2 0.7 96.0
Usage Type Count Total Avg RPE APR
serpentstalkers_trickery
aimed_shot Focus 47.6 1360.6 28.6 28.6 890.7
kill_shot Focus 4.6 46.1 10.0 10.0 543.5
multishot Focus 81.5 1630.1 20.0 20.0 495.3

Statistics & Data Analysis

Fight Length
serpentstalkers_trickery Fight Length
Count 1217
Mean 299.97
Minimum 240.10
Maximum 359.83
Spread ( max - min ) 119.74
Range [ ( max - min ) / 2 * 100% ] 19.96%
DPS
serpentstalkers_trickery Damage Per Second
Count 1217
Mean 12000.63
Minimum 10845.00
Maximum 13091.30
Spread ( max - min ) 2246.30
Range [ ( max - min ) / 2 * 100% ] 9.36%
Standard Deviation 400.1244
5th Percentile 11349.44
95th Percentile 12677.07
( 95th Percentile - 5th Percentile ) 1327.63
Mean Distribution
Standard Deviation 11.4696
95.00% Confidence Interval ( 11978.15 - 12023.11 )
Normalized 95.00% Confidence Interval ( 99.81% - 100.19% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 43
0.1% Error 4271
0.1 Scale Factor Error with Delta=300 1367
0.05 Scale Factor Error with Delta=300 5467
0.01 Scale Factor Error with Delta=300 136671
Priority Target DPS
serpentstalkers_trickery Priority Target Damage Per Second
Count 1217
Mean 3502.06
Minimum 3170.03
Maximum 3960.91
Spread ( max - min ) 790.88
Range [ ( max - min ) / 2 * 100% ] 11.29%
Standard Deviation 122.9878
5th Percentile 3313.27
95th Percentile 3724.55
( 95th Percentile - 5th Percentile ) 411.28
Mean Distribution
Standard Deviation 3.5255
95.00% Confidence Interval ( 3495.15 - 3508.97 )
Normalized 95.00% Confidence Interval ( 99.80% - 100.20% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 48
0.1% Error 4738
0.1 Scale Factor Error with Delta=300 130
0.05 Scale Factor Error with Delta=300 517
0.01 Scale Factor Error with Delta=300 12913
DPS(e)
serpentstalkers_trickery Damage Per Second (Effective)
Count 1217
Mean 12000.63
Minimum 10845.00
Maximum 13091.30
Spread ( max - min ) 2246.30
Range [ ( max - min ) / 2 * 100% ] 9.36%
Damage
serpentstalkers_trickery Damage
Count 1217
Mean 3591739.55
Minimum 2743232.74
Maximum 4419809.07
Spread ( max - min ) 1676576.33
Range [ ( max - min ) / 2 * 100% ] 23.34%
DTPS
serpentstalkers_trickery Damage Taken Per Second
Count 1217
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
serpentstalkers_trickery Healing Per Second
Count 1217
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
serpentstalkers_trickery Healing Per Second (Effective)
Count 1217
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
serpentstalkers_trickery Heal
Count 1217
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
serpentstalkers_trickery Healing Taken Per Second
Count 1217
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
serpentstalkers_trickery Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
serpentstalkers_trickeryTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
serpentstalkers_trickery Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask
1 0.00 augmentation
2 0.00 food
3 0.00 snapshot_stats
Snapshot raid buffed stats before combat begins and pre-potting is done.
4 0.00 tar_trap,if=runeforge.soulforge_embers
5 0.00 double_tap,precast_time=10,if=!covenant.kyrian&(!talent.volley|active_enemies<2)
6 0.00 aimed_shot,if=active_enemies<3
7 0.00 steady_shot,if=active_enemies>2
Default action list Executed every time the actor is available.
# count action,conditions
8 1.00 auto_shot
0.00 counter_shot,line_cd=30,if=runeforge.sephuzs_proclamation|soulbind.niyas_tools_poison|(conduit.reversal_of_fortune&!runeforge.sephuzs_proclamation)
9 3.73 use_items
A 0.00 call_action_list,name=cds
B 0.00 call_action_list,name=st,if=active_enemies<3
C 0.00 call_action_list,name=trickshots,if=active_enemies>2
actions.cds
# count action,conditions
0.00 berserking,if=buff.trueshot.up|target.time_to_die<13
D 2.97 blood_fury,if=buff.trueshot.up|target.time_to_die<16
0.00 ancestral_call,if=buff.trueshot.up|target.time_to_die<16
0.00 fireblood,if=buff.trueshot.up|target.time_to_die<9
0.00 lights_judgment,if=buff.trueshot.down
0.00 bag_of_tricks,if=buff.trueshot.down
E 1.47 potion,if=buff.trueshot.up&buff.bloodlust.up|buff.trueshot.up&target.health.pct<20|target.time_to_die<26
actions.trickshots
# count action,conditions
F 16.14 steady_shot,if=talent.steady_focus&in_flight&buff.steady_focus.remains<5
G 4.60 double_tap,if=covenant.kyrian&cooldown.resonating_arrow.remains<gcd|cooldown.rapid_fire.remains<cooldown.aimed_shot.full_recharge_time|!(talent.streamline&runeforge.surging_shots)|!covenant.kyrian
0.00 tar_trap,if=runeforge.soulforge_embers&tar_trap.remains<gcd&cooldown.flare.remains<gcd
0.00 flare,if=tar_trap.up&runeforge.soulforge_embers
0.00 explosive_shot
H 2.98 wild_spirits
0.00 resonating_arrow
0.00 volley
0.00 barrage
I 2.97 trueshot
0.00 rapid_fire,if=buff.trick_shots.remains>=execute_time&runeforge.surging_shots&buff.double_tap.down
J 47.77 aimed_shot,target_if=min:(dot.serpent_sting.remains<?action.serpent_sting.in_flight_to_target*dot.serpent_sting.duration),if=buff.trick_shots.remains>=execute_time&(buff.precise_shots.down|full_recharge_time<cast_time+gcd|buff.trueshot.up)
0.00 death_chakram,if=focus+cast_regen<focus.max
K 16.37 rapid_fire,if=buff.trick_shots.remains>=execute_time
L 74.07 multishot,if=buff.trick_shots.down|buff.precise_shots.up&focus>cost+action.aimed_shot.cost&(!talent.chimaera_shot|active_enemies>3)
0.00 chimaera_shot,if=buff.precise_shots.up&focus>cost+action.aimed_shot.cost&active_enemies<4
M 4.61 kill_shot,if=buff.dead_eye.down
0.00 a_murder_of_crows
0.00 flayed_shot
0.00 serpent_sting,target_if=min:dot.serpent_sting.remains,if=refreshable
N 7.43 multishot,if=focus>cost+action.aimed_shot.cost
O 50.66 steady_shot

Sample Sequence

0125789FHIDELJLJLKLJOLJOFLJLKLJLOJOFLJOLKLOJLOFLJLOOLJLOGKLJLOFJLOOLNJLKLOOOJLOONNJ9LOKLOFJLOLONOJLGKLNJLOFHIDLJLKLJOFLJLKLJLOFJLKLJLOFJLOOLOJLKGLOFJL9OLONJLOFKLJLOJLOFLJLONKLJLOFOLJLOOLOKGLJLOFJHIDLLJLKLJOFLJLJLJOLKLO9FJLOJLOOMOLJLKLMGOFJLOOLJLMLJOLKLOFJLMOOEJLLJLMKLOFJLMOJOLO

Sample Sequence Table

Time List # Name Target Resources Buffs
Pre precombat 0 flask serpentstalkers_trickery 100.0/100: 100% focus
Pre precombat 1 augmentation serpentstalkers_trickery 100.0/100: 100% focus
Pre precombat 2 food serpentstalkers_trickery 100.0/100: 100% focus
Pre precombat 5 double_tap Fluffy_Pillow 100.0/100: 100% focus
Pre precombat 7 steady_shot Fluffy_Pillow 100.0/100: 100% focus double_tap
0:00.000 default 8 auto_attack Fluffy_Pillow 100.0/100: 100% focus double_tap
0:00.000 default 9 use_items Fluffy_Pillow 100.0/100: 100% focus double_tap
0:00.000 trickshots F steady_shot Fluffy_Pillow 100.0/100: 100% focus double_tap
0:01.484 trickshots H wild_spirits Fluffy_Pillow 100.0/100: 100% focus bloodlust, double_tap, steady_focus
0:02.400 trickshots I trueshot Fluffy_Pillow 100.0/100: 100% focus bloodlust, double_tap, steady_focus
0:02.400 cds D blood_fury Fluffy_Pillow 100.0/100: 100% focus bloodlust, double_tap, steady_focus, trueshot
0:02.400 cds E potion Fluffy_Pillow 100.0/100: 100% focus bloodlust, blood_fury, double_tap, steady_focus, trueshot
0:02.400 trickshots L multishot Fluffy_Pillow 100.0/100: 100% focus bloodlust, blood_fury, double_tap, steady_focus, trueshot, potion_of_spectral_agility
0:03.316 trickshots J aimed_shot Fluffy_Pillow 91.3/100: 91% focus bloodlust, blood_fury, double_tap, steady_focus, trick_shots, trueshot, wild_spirits, potion_of_spectral_agility
0:04.232 trickshots L multishot Fluffy_Pillow 66.9/100: 67% focus bloodlust, blood_fury, precise_shots, steady_focus, trueshot, wild_spirits, potion_of_spectral_agility
0:05.149 trickshots J aimed_shot enemy2 58.3/100: 58% focus bloodlust, blood_fury, steady_focus, trick_shots, trueshot, wild_spirits, potion_of_spectral_agility
0:06.065 trickshots L multishot Fluffy_Pillow 34.6/100: 35% focus bloodlust, blood_fury, precise_shots, steady_focus, trueshot, wild_spirits, potion_of_spectral_agility
0:06.982 trickshots K rapid_fire Fluffy_Pillow 25.9/100: 26% focus bloodlust, blood_fury, steady_focus, trick_shots, trueshot, wild_spirits, potion_of_spectral_agility
0:08.360 trickshots L multishot Fluffy_Pillow 51.9/100: 52% focus bloodlust, blood_fury, steady_focus, trueshot, wild_spirits, potion_of_spectral_agility
0:09.275 trickshots J aimed_shot enemy3 43.2/100: 43% focus bloodlust, blood_fury, steady_focus, trick_shots, trueshot, wild_spirits, potion_of_spectral_agility
0:10.189 trickshots O steady_shot Fluffy_Pillow 19.5/100: 19% focus bloodlust, blood_fury, precise_shots, steady_focus, trueshot, wild_spirits, potion_of_spectral_agility
0:11.258 trickshots L multishot Fluffy_Pillow 47.7/100: 48% focus bloodlust, blood_fury, precise_shots, steady_focus, trueshot, wild_spirits, potion_of_spectral_agility
0:12.173 trickshots J aimed_shot enemy4 38.9/100: 39% focus bloodlust, blood_fury, steady_focus, trick_shots, trueshot, wild_spirits, potion_of_spectral_agility
0:13.088 trickshots O steady_shot Fluffy_Pillow 15.2/100: 15% focus bloodlust, blood_fury, precise_shots(2), steady_focus, trueshot, wild_spirits, potion_of_spectral_agility
0:14.156 trickshots F steady_shot Fluffy_Pillow 43.4/100: 43% focus bloodlust, blood_fury, precise_shots(2), steady_focus, trueshot, wild_spirits, potion_of_spectral_agility
0:15.224 trickshots L multishot Fluffy_Pillow 71.6/100: 72% focus bloodlust, blood_fury, precise_shots(2), steady_focus, trueshot, wild_spirits, potion_of_spectral_agility
0:16.139 trickshots J aimed_shot enemy5 62.9/100: 63% focus bloodlust, blood_fury, precise_shots, steady_focus, trick_shots, trueshot, wild_spirits, potion_of_spectral_agility
0:17.055 trickshots L multishot Fluffy_Pillow 39.2/100: 39% focus bloodlust, blood_fury, precise_shots(2), steady_focus, trueshot, wild_spirits, potion_of_spectral_agility
0:17.972 trickshots K rapid_fire Fluffy_Pillow 30.5/100: 31% focus bloodlust, precise_shots, steady_focus, trick_shots, trueshot, wild_spirits, potion_of_spectral_agility
0:19.428 trickshots L multishot Fluffy_Pillow 59.5/100: 59% focus bloodlust, precise_shots, steady_focus, trueshot, wild_spirits, potion_of_spectral_agility
0:20.344 trickshots J aimed_shot Fluffy_Pillow 50.8/100: 51% focus bloodlust, steady_focus, trick_shots, trueshot, wild_spirits, potion_of_spectral_agility
0:21.262 trickshots L multishot Fluffy_Pillow 27.1/100: 27% focus bloodlust, precise_shots, steady_focus, trueshot, potion_of_spectral_agility
0:22.177 trickshots O steady_shot Fluffy_Pillow 17.9/100: 18% focus bloodlust, steady_focus, trick_shots, potion_of_spectral_agility
0:23.245 trickshots J aimed_shot enemy2 36.7/100: 37% focus bloodlust, steady_focus, trick_shots, potion_of_spectral_agility
0:24.767 trickshots O steady_shot Fluffy_Pillow 14.2/100: 14% focus bloodlust, precise_shots, steady_focus, potion_of_spectral_agility
0:25.835 trickshots F steady_shot Fluffy_Pillow 33.0/100: 33% focus bloodlust, precise_shots, steady_focus, potion_of_spectral_agility
0:26.902 trickshots L multishot Fluffy_Pillow 51.8/100: 52% focus bloodlust, precise_shots, steady_focus, potion_of_spectral_agility
0:27.817 trickshots J aimed_shot enemy3 39.3/100: 39% focus bloodlust, steady_focus, trick_shots
0:29.341 trickshots O steady_shot Fluffy_Pillow 16.8/100: 17% focus bloodlust, precise_shots(2), steady_focus
0:30.407 trickshots L multishot Fluffy_Pillow 35.6/100: 36% focus bloodlust, precise_shots(2), steady_focus
0:31.322 trickshots K rapid_fire Fluffy_Pillow 23.1/100: 23% focus bloodlust, precise_shots, steady_focus, trick_shots
0:32.809 trickshots L multishot Fluffy_Pillow 42.4/100: 42% focus bloodlust, precise_shots, steady_focus
0:33.725 trickshots O steady_shot Fluffy_Pillow 29.9/100: 30% focus bloodlust, steady_focus, trick_shots
0:34.795 trickshots J aimed_shot enemy4 48.7/100: 49% focus bloodlust, steady_focus, trick_shots
0:36.319 trickshots L multishot Fluffy_Pillow 26.3/100: 26% focus bloodlust, precise_shots(2), steady_focus
0:37.235 trickshots O steady_shot Fluffy_Pillow 13.8/100: 14% focus bloodlust, lock_and_load, precise_shots, steady_focus, trick_shots
0:38.302 trickshots F steady_shot Fluffy_Pillow 32.6/100: 33% focus bloodlust, lock_and_load, precise_shots, steady_focus, trick_shots
0:39.369 trickshots L multishot Fluffy_Pillow 51.3/100: 51% focus bloodlust, lock_and_load, precise_shots, steady_focus, trick_shots
0:40.285 trickshots J aimed_shot enemy5 38.9/100: 39% focus bloodlust, lock_and_load, steady_focus, trick_shots
0:41.201 trickshots L multishot Fluffy_Pillow 46.0/100: 46% focus precise_shots(2), steady_focus
0:42.390 trickshots O steady_shot Fluffy_Pillow 33.6/100: 34% focus precise_shots, steady_focus, trick_shots
0:43.777 trickshots O steady_shot Fluffy_Pillow 52.3/100: 52% focus precise_shots, steady_focus, trick_shots
0:45.163 trickshots L multishot Fluffy_Pillow 71.1/100: 71% focus precise_shots, steady_focus, trick_shots
0:46.353 trickshots J aimed_shot Fluffy_Pillow 58.6/100: 59% focus steady_focus, trick_shots
0:48.333 trickshots L multishot Fluffy_Pillow 36.2/100: 36% focus precise_shots(2), steady_focus
0:49.521 trickshots O steady_shot Fluffy_Pillow 23.7/100: 24% focus precise_shots, steady_focus, trick_shots
0:50.907 trickshots G double_tap Fluffy_Pillow 42.5/100: 42% focus precise_shots, steady_focus, trick_shots
0:52.096 trickshots K rapid_fire Fluffy_Pillow 50.0/100: 50% focus double_tap, precise_shots, steady_focus, trick_shots
0:54.021 trickshots L multishot Fluffy_Pillow 76.2/100: 76% focus precise_shots, steady_focus
0:55.211 trickshots J aimed_shot enemy2 63.7/100: 64% focus steady_focus, trick_shots
0:57.190 trickshots L multishot Fluffy_Pillow 41.2/100: 41% focus precise_shots, steady_focus
0:58.379 trickshots O steady_shot Fluffy_Pillow 28.8/100: 29% focus steady_focus, trick_shots
0:59.768 trickshots F steady_shot Fluffy_Pillow 47.6/100: 48% focus steady_focus, trick_shots
1:01.153 trickshots J aimed_shot enemy3 65.9/100: 66% focus steady_focus, trick_shots
1:03.133 trickshots L multishot Fluffy_Pillow 43.4/100: 43% focus precise_shots(2), steady_focus
1:04.322 trickshots O steady_shot Fluffy_Pillow 31.0/100: 31% focus precise_shots, steady_focus, trick_shots
1:05.706 trickshots O steady_shot Fluffy_Pillow 49.7/100: 50% focus precise_shots, steady_focus, trick_shots
1:07.092 trickshots L multishot Fluffy_Pillow 68.5/100: 68% focus precise_shots, steady_focus, trick_shots
1:08.280 trickshots N multishot Fluffy_Pillow 56.0/100: 56% focus steady_focus, trick_shots
1:09.470 trickshots J aimed_shot Fluffy_Pillow 43.5/100: 44% focus steady_focus, trick_shots
1:11.449 trickshots L multishot Fluffy_Pillow 21.1/100: 21% focus precise_shots, steady_focus
1:12.638 trickshots K rapid_fire Fluffy_Pillow 8.6/100: 9% focus steady_focus, trick_shots
1:14.458 trickshots L multishot Fluffy_Pillow 27.1/100: 27% focus steady_focus
1:15.648 trickshots O steady_shot Fluffy_Pillow 14.7/100: 15% focus steady_focus, trick_shots
1:17.034 trickshots O steady_shot Fluffy_Pillow 33.4/100: 33% focus steady_focus, trick_shots
1:18.419 trickshots O steady_shot Fluffy_Pillow 52.2/100: 52% focus steady_focus, trick_shots
1:19.807 trickshots J aimed_shot enemy2 71.0/100: 71% focus steady_focus, trick_shots
1:21.785 trickshots L multishot Fluffy_Pillow 48.5/100: 48% focus precise_shots, steady_focus
1:22.974 trickshots O steady_shot Fluffy_Pillow 36.0/100: 36% focus steady_focus, trick_shots
1:24.361 trickshots O steady_shot Fluffy_Pillow 54.8/100: 55% focus steady_focus, trick_shots
1:25.749 trickshots N multishot Fluffy_Pillow 73.6/100: 74% focus steady_focus, trick_shots
1:26.936 trickshots N multishot Fluffy_Pillow 61.1/100: 61% focus steady_focus, trick_shots
1:28.125 trickshots J aimed_shot enemy3 48.6/100: 49% focus steady_focus, trick_shots
1:30.239 default 9 use_items Fluffy_Pillow 27.0/100: 27% focus precise_shots(2), steady_focus
1:30.239 trickshots L multishot Fluffy_Pillow 27.0/100: 27% focus precise_shots(2), steady_focus
1:31.428 trickshots O steady_shot Fluffy_Pillow 14.5/100: 15% focus precise_shots, steady_focus, trick_shots
1:32.816 trickshots K rapid_fire Fluffy_Pillow 33.3/100: 33% focus precise_shots, steady_focus, trick_shots
1:34.614 trickshots L multishot Fluffy_Pillow 51.7/100: 52% focus precise_shots, steady_focus
1:35.804 trickshots O steady_shot Fluffy_Pillow 39.2/100: 39% focus steady_focus, trick_shots
1:37.189 trickshots F steady_shot Fluffy_Pillow 58.0/100: 58% focus steady_focus, trick_shots
1:38.576 trickshots J aimed_shot Fluffy_Pillow 76.8/100: 77% focus steady_focus, trick_shots
1:40.555 trickshots L multishot Fluffy_Pillow 54.3/100: 54% focus precise_shots(2), steady_focus
1:41.744 trickshots O steady_shot Fluffy_Pillow 41.8/100: 42% focus precise_shots, steady_focus, trick_shots
1:43.132 trickshots L multishot Fluffy_Pillow 60.6/100: 61% focus precise_shots, steady_focus, trick_shots
1:44.321 trickshots O steady_shot Fluffy_Pillow 48.1/100: 48% focus steady_focus, trick_shots
1:45.709 trickshots N multishot Fluffy_Pillow 66.9/100: 67% focus steady_focus, trick_shots
1:46.895 trickshots O steady_shot Fluffy_Pillow 54.4/100: 54% focus steady_focus, trick_shots
1:48.282 trickshots J aimed_shot enemy2 73.2/100: 73% focus steady_focus, trick_shots
1:50.262 trickshots L multishot Fluffy_Pillow 50.7/100: 51% focus precise_shots, steady_focus
1:51.450 trickshots G double_tap Fluffy_Pillow 38.2/100: 38% focus steady_focus, trick_shots
1:52.637 trickshots K rapid_fire Fluffy_Pillow 45.8/100: 46% focus double_tap, steady_focus, trick_shots
1:54.743 trickshots L multishot Fluffy_Pillow 72.6/100: 73% focus
1:56.014 trickshots N multishot Fluffy_Pillow 60.1/100: 60% focus trick_shots
1:57.288 trickshots J aimed_shot enemy3 47.7/100: 48% focus trick_shots
1:59.405 trickshots L multishot Fluffy_Pillow 25.2/100: 25% focus precise_shots(2)
2:00.678 trickshots O steady_shot Fluffy_Pillow 12.7/100: 13% focus precise_shots, trick_shots
2:02.162 trickshots F steady_shot Fluffy_Pillow 31.5/100: 31% focus precise_shots, trick_shots
2:03.646 trickshots H wild_spirits Fluffy_Pillow 50.3/100: 50% focus precise_shots, steady_focus, trick_shots
2:04.834 trickshots I trueshot Fluffy_Pillow 57.8/100: 58% focus precise_shots, steady_focus, trick_shots
2:04.834 cds D blood_fury Fluffy_Pillow 57.8/100: 58% focus precise_shots, steady_focus, trick_shots, trueshot
2:04.834 trickshots L multishot Fluffy_Pillow 57.8/100: 58% focus blood_fury, precise_shots, steady_focus, trick_shots, trueshot
2:06.021 trickshots J aimed_shot Fluffy_Pillow 49.1/100: 49% focus blood_fury, steady_focus, trick_shots, trueshot, wild_spirits
2:07.208 trickshots L multishot Fluffy_Pillow 25.3/100: 25% focus blood_fury, precise_shots, steady_focus, trueshot, wild_spirits
2:08.395 trickshots K rapid_fire Fluffy_Pillow 16.6/100: 17% focus blood_fury, steady_focus, trick_shots, trueshot, wild_spirits
2:10.206 trickshots L multishot Fluffy_Pillow 45.8/100: 46% focus blood_fury, steady_focus, trueshot, wild_spirits
2:11.395 trickshots J aimed_shot enemy2 37.1/100: 37% focus blood_fury, steady_focus, trick_shots, trueshot, wild_spirits
2:12.583 trickshots O steady_shot Fluffy_Pillow 13.4/100: 13% focus blood_fury, precise_shots, steady_focus, trueshot, wild_spirits
2:13.971 trickshots F steady_shot Fluffy_Pillow 41.5/100: 42% focus blood_fury, precise_shots, steady_focus, trueshot, wild_spirits
2:15.357 trickshots L multishot Fluffy_Pillow 69.7/100: 70% focus blood_fury, precise_shots, steady_focus, trueshot, wild_spirits
2:16.547 trickshots J aimed_shot enemy4 61.0/100: 61% focus blood_fury, steady_focus, trick_shots, trueshot, wild_spirits
2:17.736 trickshots L multishot Fluffy_Pillow 37.3/100: 37% focus blood_fury, precise_shots, steady_focus, trueshot, wild_spirits
2:18.925 trickshots K rapid_fire Fluffy_Pillow 28.6/100: 29% focus blood_fury, steady_focus, trick_shots, trueshot, wild_spirits
2:20.750 trickshots L multishot Fluffy_Pillow 55.9/100: 56% focus steady_focus, trueshot, wild_spirits
2:21.937 trickshots J aimed_shot enemy3 47.2/100: 47% focus steady_focus, trick_shots, trueshot, wild_spirits
2:23.126 trickshots L multishot Fluffy_Pillow 23.5/100: 23% focus precise_shots, steady_focus, trueshot
2:24.316 trickshots O steady_shot Fluffy_Pillow 14.7/100: 15% focus steady_focus, trick_shots, trueshot
2:25.703 trickshots F steady_shot Fluffy_Pillow 34.1/100: 34% focus steady_focus, trick_shots
2:27.090 trickshots J aimed_shot Fluffy_Pillow 52.8/100: 53% focus lock_and_load, steady_focus, trick_shots
2:28.278 trickshots L multishot Fluffy_Pillow 60.4/100: 60% focus precise_shots(2), steady_focus
2:29.467 trickshots K rapid_fire Fluffy_Pillow 47.9/100: 48% focus precise_shots, steady_focus, trick_shots
2:31.359 trickshots L multishot Fluffy_Pillow 66.9/100: 67% focus precise_shots, steady_focus
2:32.547 trickshots J aimed_shot enemy5 54.4/100: 54% focus steady_focus, trick_shots
2:34.526 trickshots L multishot Fluffy_Pillow 31.9/100: 32% focus precise_shots, steady_focus
2:35.713 trickshots O steady_shot Fluffy_Pillow 19.4/100: 19% focus steady_focus, trick_shots
2:37.100 trickshots F steady_shot Fluffy_Pillow 38.2/100: 38% focus steady_focus, trick_shots
2:38.486 trickshots J aimed_shot enemy2 57.0/100: 57% focus steady_focus, trick_shots
2:40.464 trickshots L multishot Fluffy_Pillow 34.5/100: 34% focus precise_shots(2), steady_focus
2:41.653 trickshots O steady_shot Fluffy_Pillow 22.0/100: 22% focus precise_shots, steady_focus, trick_shots
2:43.040 trickshots O steady_shot Fluffy_Pillow 40.8/100: 41% focus precise_shots, steady_focus, trick_shots
2:44.427 trickshots L multishot Fluffy_Pillow 59.6/100: 60% focus precise_shots, steady_focus, trick_shots
2:45.614 trickshots O steady_shot Fluffy_Pillow 47.1/100: 47% focus steady_focus, trick_shots
2:47.001 trickshots J aimed_shot Fluffy_Pillow 65.9/100: 66% focus steady_focus, trick_shots
2:48.980 trickshots L multishot Fluffy_Pillow 43.4/100: 43% focus precise_shots(2), steady_focus
2:50.169 trickshots K rapid_fire Fluffy_Pillow 30.9/100: 31% focus precise_shots, steady_focus, trick_shots
2:51.928 trickshots G double_tap Fluffy_Pillow 49.0/100: 49% focus precise_shots, steady_focus
2:53.114 trickshots L multishot Fluffy_Pillow 56.5/100: 57% focus double_tap, precise_shots, steady_focus
2:54.302 trickshots O steady_shot Fluffy_Pillow 44.1/100: 44% focus double_tap, steady_focus, trick_shots
2:55.690 trickshots F steady_shot Fluffy_Pillow 62.9/100: 63% focus double_tap, steady_focus, trick_shots
2:57.077 trickshots J aimed_shot enemy3 81.6/100: 82% focus double_tap, steady_focus, trick_shots
2:59.054 trickshots L multishot Fluffy_Pillow 59.1/100: 59% focus precise_shots(2), steady_focus
3:00.244 default 9 use_items Fluffy_Pillow 46.7/100: 47% focus precise_shots, steady_focus, trick_shots
3:00.244 trickshots O steady_shot Fluffy_Pillow 46.7/100: 47% focus precise_shots, steady_focus, trick_shots
3:01.630 trickshots L multishot Fluffy_Pillow 65.4/100: 65% focus precise_shots, steady_focus, trick_shots
3:02.818 trickshots O steady_shot Fluffy_Pillow 53.0/100: 53% focus steady_focus, trick_shots
3:04.203 trickshots N multishot Fluffy_Pillow 71.7/100: 72% focus steady_focus, trick_shots
3:05.391 trickshots J aimed_shot enemy2 59.3/100: 59% focus steady_focus, trick_shots
3:07.371 trickshots L multishot Fluffy_Pillow 36.8/100: 37% focus precise_shots, steady_focus
3:08.561 trickshots O steady_shot Fluffy_Pillow 24.3/100: 24% focus steady_focus, trick_shots
3:09.948 trickshots F steady_shot Fluffy_Pillow 43.1/100: 43% focus steady_focus, trick_shots
3:11.335 trickshots K rapid_fire Fluffy_Pillow 61.9/100: 62% focus steady_focus, trick_shots
3:13.117 trickshots L multishot Fluffy_Pillow 80.2/100: 80% focus steady_focus
3:14.307 trickshots J aimed_shot Fluffy_Pillow 67.7/100: 68% focus steady_focus, trick_shots
3:16.463 trickshots L multishot Fluffy_Pillow 46.3/100: 46% focus precise_shots, steady_focus
3:17.652 trickshots O steady_shot Fluffy_Pillow 33.9/100: 34% focus steady_focus, trick_shots
3:19.039 trickshots J aimed_shot enemy3 52.6/100: 53% focus lock_and_load, steady_focus, trick_shots
3:20.227 trickshots L multishot Fluffy_Pillow 60.2/100: 60% focus precise_shots(2), steady_focus
3:21.415 trickshots O steady_shot Fluffy_Pillow 47.7/100: 48% focus precise_shots, steady_focus, trick_shots
3:22.801 trickshots F steady_shot Fluffy_Pillow 66.4/100: 66% focus precise_shots, steady_focus, trick_shots
3:24.188 trickshots L multishot Fluffy_Pillow 85.2/100: 85% focus precise_shots, steady_focus, trick_shots
3:25.377 trickshots J aimed_shot enemy4 72.7/100: 73% focus steady_focus, trick_shots
3:27.354 trickshots L multishot Fluffy_Pillow 50.3/100: 50% focus precise_shots, steady_focus
3:28.544 trickshots O steady_shot Fluffy_Pillow 37.8/100: 38% focus steady_focus, trick_shots
3:29.930 trickshots N multishot Fluffy_Pillow 56.6/100: 57% focus steady_focus, trick_shots
3:31.118 trickshots K rapid_fire Fluffy_Pillow 44.1/100: 44% focus steady_focus, trick_shots
3:33.152 trickshots L multishot Fluffy_Pillow 64.0/100: 64% focus steady_focus
3:34.341 trickshots J aimed_shot enemy2 51.5/100: 51% focus steady_focus, trick_shots
3:36.319 trickshots L multishot Fluffy_Pillow 29.0/100: 29% focus precise_shots(2), steady_focus
3:37.506 trickshots O steady_shot Fluffy_Pillow 16.5/100: 17% focus precise_shots, steady_focus, trick_shots
3:38.893 trickshots F steady_shot Fluffy_Pillow 35.3/100: 35% focus precise_shots, steady_focus, trick_shots
3:40.279 trickshots O steady_shot Fluffy_Pillow 53.6/100: 54% focus precise_shots, steady_focus, trick_shots
3:41.665 trickshots L multishot Fluffy_Pillow 72.4/100: 72% focus precise_shots, steady_focus, trick_shots
3:42.854 trickshots J aimed_shot Fluffy_Pillow 59.9/100: 60% focus steady_focus, trick_shots
3:44.971 trickshots L multishot Fluffy_Pillow 38.3/100: 38% focus precise_shots(2), steady_focus
3:46.159 trickshots O steady_shot Fluffy_Pillow 25.8/100: 26% focus precise_shots, steady_focus, trick_shots
3:47.546 trickshots O steady_shot Fluffy_Pillow 44.6/100: 45% focus precise_shots, steady_focus, trick_shots
3:48.931 trickshots L multishot Fluffy_Pillow 63.4/100: 63% focus precise_shots, steady_focus, trick_shots
3:50.119 trickshots O steady_shot Fluffy_Pillow 50.9/100: 51% focus steady_focus, trick_shots
3:51.507 trickshots K rapid_fire Fluffy_Pillow 69.7/100: 70% focus steady_focus, trick_shots
3:53.420 trickshots G double_tap Fluffy_Pillow 88.8/100: 89% focus steady_focus
3:54.610 trickshots L multishot Fluffy_Pillow 96.3/100: 96% focus double_tap, steady_focus
3:55.798 trickshots J aimed_shot enemy3 83.8/100: 84% focus double_tap, steady_focus, trick_shots
3:57.776 trickshots L multishot Fluffy_Pillow 61.4/100: 61% focus precise_shots, steady_focus
3:58.964 trickshots O steady_shot Fluffy_Pillow 48.9/100: 49% focus steady_focus, trick_shots
4:00.351 trickshots F steady_shot Fluffy_Pillow 67.7/100: 68% focus steady_focus, trick_shots
4:01.739 trickshots J aimed_shot enemy2 86.4/100: 86% focus steady_focus, trick_shots
4:03.928 trickshots H wild_spirits Fluffy_Pillow 65.0/100: 65% focus precise_shots(2), steady_focus
4:05.116 trickshots I trueshot Fluffy_Pillow 72.5/100: 73% focus precise_shots(2), steady_focus
4:05.116 cds D blood_fury Fluffy_Pillow 72.5/100: 73% focus precise_shots(2), steady_focus, trueshot
4:05.116 trickshots L multishot Fluffy_Pillow 72.5/100: 73% focus blood_fury, precise_shots(2), steady_focus, trueshot
4:06.306 trickshots L multishot Fluffy_Pillow 63.8/100: 64% focus blood_fury, precise_shots, steady_focus, trick_shots, trueshot, wild_spirits
4:07.495 trickshots J aimed_shot Fluffy_Pillow 55.1/100: 55% focus blood_fury, steady_focus, trick_shots, trueshot, wild_spirits
4:08.683 trickshots L multishot Fluffy_Pillow 31.4/100: 31% focus blood_fury, precise_shots, steady_focus, trueshot, wild_spirits
4:09.872 trickshots K rapid_fire Fluffy_Pillow 22.7/100: 23% focus blood_fury, steady_focus, trick_shots, trueshot, wild_spirits
4:11.828 trickshots L multishot Fluffy_Pillow 52.3/100: 52% focus blood_fury, steady_focus, trueshot, wild_spirits
4:13.016 trickshots J aimed_shot enemy4 43.5/100: 44% focus blood_fury, steady_focus, trick_shots, trueshot, wild_spirits
4:14.205 trickshots O steady_shot Fluffy_Pillow 19.8/100: 20% focus blood_fury, precise_shots(2), steady_focus, trueshot, wild_spirits
4:15.593 trickshots F steady_shot Fluffy_Pillow 48.0/100: 48% focus blood_fury, precise_shots(2), steady_focus, trueshot, wild_spirits
4:16.979 trickshots L multishot Fluffy_Pillow 76.0/100: 76% focus blood_fury, precise_shots(2), steady_focus, trueshot, wild_spirits
4:18.167 trickshots J aimed_shot enemy3 67.3/100: 67% focus blood_fury, precise_shots, steady_focus, trick_shots, trueshot, wild_spirits
4:19.357 trickshots L multishot Fluffy_Pillow 43.6/100: 44% focus blood_fury, lock_and_load, precise_shots(2), steady_focus, trueshot, wild_spirits
4:20.544 trickshots J aimed_shot enemy5 34.9/100: 35% focus lock_and_load, precise_shots, steady_focus, trick_shots, trueshot, wild_spirits
4:21.733 trickshots L multishot Fluffy_Pillow 46.1/100: 46% focus precise_shots(2), steady_focus, trueshot, wild_spirits
4:22.919 trickshots J aimed_shot enemy2 37.4/100: 37% focus precise_shots, steady_focus, trick_shots, trueshot, wild_spirits
4:24.109 trickshots O steady_shot Fluffy_Pillow 13.7/100: 14% focus precise_shots(2), steady_focus, trueshot
4:25.496 trickshots L multishot Fluffy_Pillow 34.6/100: 35% focus precise_shots(2), steady_focus
4:26.685 trickshots K rapid_fire Fluffy_Pillow 22.1/100: 22% focus precise_shots, steady_focus, trick_shots
4:28.510 trickshots L multishot Fluffy_Pillow 40.6/100: 41% focus precise_shots, steady_focus
4:29.698 trickshots O steady_shot Fluffy_Pillow 28.2/100: 28% focus steady_focus, trick_shots
4:31.084 default 9 use_items Fluffy_Pillow 46.9/100: 47% focus steady_focus, trick_shots
4:31.084 trickshots F steady_shot Fluffy_Pillow 46.9/100: 47% focus steady_focus, trick_shots
4:32.471 trickshots J aimed_shot Fluffy_Pillow 65.5/100: 66% focus steady_focus, trick_shots
4:34.449 trickshots L multishot Fluffy_Pillow 43.0/100: 43% focus precise_shots, steady_focus
4:35.638 trickshots O steady_shot Fluffy_Pillow 30.5/100: 31% focus steady_focus, trick_shots
4:37.025 trickshots J aimed_shot enemy4 49.3/100: 49% focus steady_focus, trick_shots
4:39.004 trickshots L multishot Fluffy_Pillow 26.9/100: 27% focus precise_shots(2), steady_focus
4:40.192 trickshots O steady_shot Fluffy_Pillow 14.4/100: 14% focus precise_shots, steady_focus, trick_shots
4:41.580 trickshots O steady_shot Fluffy_Pillow 33.2/100: 33% focus precise_shots, steady_focus, trick_shots
4:42.967 trickshots M kill_shot Fluffy_Pillow 51.9/100: 52% focus precise_shots, steady_focus, trick_shots
4:44.156 trickshots O steady_shot Fluffy_Pillow 49.5/100: 49% focus precise_shots, steady_focus, trick_shots
4:45.543 trickshots L multishot Fluffy_Pillow 68.2/100: 68% focus precise_shots, steady_focus, trick_shots
4:46.732 trickshots J aimed_shot enemy2 55.8/100: 56% focus steady_focus, trick_shots
4:48.711 trickshots L multishot Fluffy_Pillow 33.3/100: 33% focus precise_shots(2), steady_focus
4:49.900 trickshots K rapid_fire Fluffy_Pillow 20.8/100: 21% focus precise_shots, steady_focus, trick_shots
4:51.659 trickshots L multishot Fluffy_Pillow 38.9/100: 39% focus precise_shots, steady_focus
4:52.847 trickshots M kill_shot Fluffy_Pillow 26.5/100: 26% focus steady_focus, trick_shots
4:54.157 trickshots G double_tap Fluffy_Pillow 24.8/100: 25% focus steady_focus, trick_shots
4:55.347 trickshots O steady_shot Fluffy_Pillow 32.3/100: 32% focus double_tap, steady_focus, trick_shots
4:56.735 trickshots F steady_shot Fluffy_Pillow 51.1/100: 51% focus double_tap, steady_focus, trick_shots
4:58.121 trickshots J aimed_shot Fluffy_Pillow 69.8/100: 70% focus double_tap, steady_focus, trick_shots
5:00.100 trickshots L multishot Fluffy_Pillow 47.3/100: 47% focus precise_shots(2), steady_focus
5:01.288 trickshots O steady_shot Fluffy_Pillow 34.8/100: 35% focus precise_shots, steady_focus, trick_shots
5:02.672 trickshots O steady_shot Fluffy_Pillow 53.6/100: 54% focus precise_shots, steady_focus, trick_shots
5:04.057 trickshots L multishot Fluffy_Pillow 72.4/100: 72% focus precise_shots, steady_focus, trick_shots
5:05.247 trickshots J aimed_shot enemy3 59.9/100: 60% focus steady_focus, trick_shots
5:07.227 trickshots L multishot Fluffy_Pillow 37.4/100: 37% focus precise_shots(2), steady_focus
5:08.415 trickshots M kill_shot Fluffy_Pillow 24.9/100: 25% focus precise_shots, steady_focus, trick_shots
5:09.602 trickshots L multishot Fluffy_Pillow 22.5/100: 22% focus lock_and_load, precise_shots, steady_focus, trick_shots
5:10.792 trickshots J aimed_shot enemy2 10.0/100: 10% focus lock_and_load, steady_focus, trick_shots
5:11.979 trickshots O steady_shot Fluffy_Pillow 17.5/100: 17% focus precise_shots, steady_focus
5:13.365 trickshots L multishot Fluffy_Pillow 36.3/100: 36% focus precise_shots, steady_focus
5:14.554 trickshots K rapid_fire Fluffy_Pillow 23.8/100: 24% focus steady_focus, trick_shots
5:16.387 trickshots L multishot Fluffy_Pillow 42.4/100: 42% focus steady_focus
5:17.576 trickshots O steady_shot Fluffy_Pillow 29.9/100: 30% focus steady_focus, trick_shots
5:18.962 trickshots F steady_shot Fluffy_Pillow 48.7/100: 49% focus steady_focus, trick_shots
5:20.349 trickshots J aimed_shot enemy4 66.9/100: 67% focus steady_focus, trick_shots
5:22.326 trickshots L multishot Fluffy_Pillow 44.4/100: 44% focus precise_shots(2), steady_focus
5:23.514 trickshots M kill_shot Fluffy_Pillow 32.0/100: 32% focus precise_shots, steady_focus, trick_shots
5:24.703 trickshots O steady_shot Fluffy_Pillow 29.5/100: 29% focus precise_shots, steady_focus, trick_shots
5:26.090 trickshots O steady_shot Fluffy_Pillow 48.3/100: 48% focus precise_shots, steady_focus, trick_shots
5:27.477 cds E potion Fluffy_Pillow 67.1/100: 67% focus lock_and_load, precise_shots, steady_focus, trick_shots
5:27.477 trickshots J aimed_shot Fluffy_Pillow 67.1/100: 67% focus lock_and_load, precise_shots, steady_focus, trick_shots, potion_of_spectral_agility
5:28.666 trickshots L multishot Fluffy_Pillow 74.6/100: 75% focus precise_shots(2), steady_focus, potion_of_spectral_agility
5:29.855 trickshots L multishot Fluffy_Pillow 62.1/100: 62% focus precise_shots, steady_focus, trick_shots, potion_of_spectral_agility
5:31.044 trickshots J aimed_shot enemy3 49.6/100: 50% focus steady_focus, trick_shots, potion_of_spectral_agility
5:33.023 trickshots L multishot Fluffy_Pillow 27.2/100: 27% focus precise_shots, steady_focus, potion_of_spectral_agility
5:34.213 trickshots M kill_shot Fluffy_Pillow 14.7/100: 15% focus steady_focus, trick_shots, potion_of_spectral_agility
5:35.402 trickshots K rapid_fire Fluffy_Pillow 12.2/100: 12% focus steady_focus, trick_shots, potion_of_spectral_agility
5:37.227 trickshots L multishot Fluffy_Pillow 30.8/100: 31% focus steady_focus, potion_of_spectral_agility
5:38.413 trickshots O steady_shot Fluffy_Pillow 18.3/100: 18% focus steady_focus, trick_shots, potion_of_spectral_agility
5:39.799 trickshots F steady_shot Fluffy_Pillow 37.0/100: 37% focus steady_focus, trick_shots, potion_of_spectral_agility
5:41.186 trickshots J aimed_shot enemy2 55.8/100: 56% focus steady_focus, trick_shots, potion_of_spectral_agility
5:43.164 trickshots L multishot Fluffy_Pillow 33.3/100: 33% focus precise_shots, steady_focus, potion_of_spectral_agility
5:44.354 trickshots M kill_shot Fluffy_Pillow 20.9/100: 21% focus steady_focus, trick_shots, potion_of_spectral_agility
5:45.542 trickshots O steady_shot Fluffy_Pillow 18.4/100: 18% focus steady_focus, trick_shots, potion_of_spectral_agility
5:46.929 trickshots J aimed_shot Fluffy_Pillow 37.2/100: 37% focus steady_focus, trick_shots, potion_of_spectral_agility
5:48.908 trickshots O steady_shot Fluffy_Pillow 14.7/100: 15% focus precise_shots, steady_focus, potion_of_spectral_agility
5:50.295 trickshots L multishot Fluffy_Pillow 33.5/100: 33% focus precise_shots, steady_focus, potion_of_spectral_agility
5:51.484 trickshots O steady_shot Fluffy_Pillow 21.0/100: 21% focus steady_focus, trick_shots, potion_of_spectral_agility

Stats

Level Bonus (60) Race Bonus (orc) Raid-Buffed Unbuffed Gear Amount
Strength 274 3 295 277 0
Agility 450 -3 1411 1297 789 (677)
Stamina 414 1 1800 1715 1300
Intellect 369 -1 405 368 0
Spirit 0 0 0 0 0
Health 36000 34300 0
Focus 100 100 0
Spell Power 405 368 0
Crit 22.66% 22.66% 443
Haste 18.30% 18.30% 604
Versatility 3.65% 3.65% 146
Attack Power 1482 1297 0
Mastery 14.00% 14.00% 504
Armor 818 818 818
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 217.00
Local Head Helm of Insatiable Appetite
ilevel: 213, stats: { 103 Armor, +126 Sta, +92 Haste, +40 Mastery, +72 AgiInt }
Local Neck Noble's Birthstone Pendant
ilevel: 213, stats: { +71 Sta, +47 Crit, +147 Mastery }
Local Shoulders Boneshatter Pauldrons
ilevel: 235, stats: { 107 Armor, +124 Sta, +44 unknown(24), +44 unknown(25), +66 AgiInt }
item effects: { equip: Serpentstalker's Trickery }
Local Chest Master Huntsman's Bandolier
ilevel: 213, stats: { 137 Armor, +126 Sta, +45 Crit, +86 Mastery, +72 AgiInt }, enchant: { +20 StrAgi }
Local Waist Load-Bearing Belt
ilevel: 213, stats: { 77 Armor, +95 Sta, +69 Haste, +30 Vers, +54 AgiInt }
Local Legs Greaves of Enigmatic Energies
ilevel: 213, stats: { 120 Armor, +126 Sta, +91 Crit, +41 Mastery, +72 AgiInt }
Local Feet Stoneclas Stompers
ilevel: 213, stats: { 86 Armor, +95 Sta, +69 Crit, +30 Mastery, +54 AgiInt }, enchant: { +15 Agi }
Local Wrists Bangles of Errant Pride
ilevel: 213, stats: { 69 Armor, +71 Sta, +48 Crit, +24 Mastery, +40 AgiInt }
Local Hands Oathsworn Soldier's Gauntlets
ilevel: 220, stats: { 80 Armor, +104 Sta, +67 Crit, +36 Haste, +58 AgiInt }
Local Finger1 Most Regal Signet of Sire Denathrius
ilevel: 220, stats: { +77 Sta, +161 Haste, +44 Mastery }, enchant: { +16 Crit }
item effects: { equip: Denathrius' Privilege }
Local Finger2 Ritualist's Treasured Ring
ilevel: 213, stats: { +71 Sta, +44 Crit, +149 Haste }, enchant: { +16 Crit }
Local Trinket1 Dreadfire Vessel
ilevel: 220, stats: { +73 StrAgiInt }, enchant: shadowcore_oil
item effects: { use: Dreadfire Vessel }
Local Trinket2 Stone Legion Heraldry
ilevel: 220, stats: { +73 StrAgi }
item effects: { equip: Stone Legionnaire }
Local Back Crest of the Legionnaire General
ilevel: 220, stats: { 39 Armor, +77 Sta, +52 Haste, +24 Vers, +43 StrAgiInt }
Local Main Hand Deadeye Blunderbuss
ilevel: 220, weapon: { 121 - 227, 3 }, stats: { +77 Agi, +137 Sta, +45 Haste, +92 Mastery }, enchant: sinful_revelation

Profile

hunter="serpentstalkers_trickery"
source=default
spec=marksmanship
level=60
race=orc
role=attack
position=ranged_back
talents=1101032
covenant=night_fae
soulbind=140:6//188:6

# Default consumables
potion=spectral_agility
flask=spectral_flask_of_power
food=feast_of_gluttonous_hedonism
augmentation=veiled

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask
actions.precombat+=/augmentation
actions.precombat+=/food
# Snapshot raid buffed stats before combat begins and pre-potting is done.
actions.precombat+=/snapshot_stats
actions.precombat+=/tar_trap,if=runeforge.soulforge_embers
actions.precombat+=/double_tap,precast_time=10,if=!covenant.kyrian&(!talent.volley|active_enemies<2)
actions.precombat+=/aimed_shot,if=active_enemies<3
actions.precombat+=/steady_shot,if=active_enemies>2

# Executed every time the actor is available.
actions=auto_shot
actions+=/counter_shot,line_cd=30,if=runeforge.sephuzs_proclamation|soulbind.niyas_tools_poison|(conduit.reversal_of_fortune&!runeforge.sephuzs_proclamation)
actions+=/use_items
actions+=/call_action_list,name=cds
actions+=/call_action_list,name=st,if=active_enemies<3
actions+=/call_action_list,name=trickshots,if=active_enemies>2

actions.cds=berserking,if=buff.trueshot.up|target.time_to_die<13
actions.cds+=/blood_fury,if=buff.trueshot.up|target.time_to_die<16
actions.cds+=/ancestral_call,if=buff.trueshot.up|target.time_to_die<16
actions.cds+=/fireblood,if=buff.trueshot.up|target.time_to_die<9
actions.cds+=/lights_judgment,if=buff.trueshot.down
actions.cds+=/bag_of_tricks,if=buff.trueshot.down
actions.cds+=/potion,if=buff.trueshot.up&buff.bloodlust.up|buff.trueshot.up&target.health.pct<20|target.time_to_die<26

actions.st=steady_shot,if=talent.steady_focus&(prev_gcd.1.steady_shot&buff.steady_focus.remains<5|buff.steady_focus.down)
actions.st+=/kill_shot
actions.st+=/double_tap,if=covenant.kyrian&cooldown.resonating_arrow.remains<gcd|!covenant.kyrian&(cooldown.aimed_shot.up|cooldown.rapid_fire.remains>cooldown.aimed_shot.remains)
actions.st+=/flare,if=tar_trap.up&runeforge.soulforge_embers
actions.st+=/tar_trap,if=runeforge.soulforge_embers&tar_trap.remains<gcd&cooldown.flare.remains<gcd
actions.st+=/explosive_shot
actions.st+=/wild_spirits
actions.st+=/flayed_shot
actions.st+=/death_chakram,if=focus+cast_regen<focus.max
actions.st+=/volley,if=buff.precise_shots.down|!talent.chimaera_shot|active_enemies<2
actions.st+=/a_murder_of_crows
actions.st+=/resonating_arrow
actions.st+=/trueshot,if=buff.precise_shots.down|buff.resonating_arrow.up|buff.wild_spirits.up|buff.volley.up&active_enemies>1
actions.st+=/aimed_shot,target_if=min:(dot.serpent_sting.remains<?action.serpent_sting.in_flight_to_target*dot.serpent_sting.duration),if=buff.precise_shots.down|(buff.trueshot.up|full_recharge_time<gcd+cast_time)&(!talent.chimaera_shot|active_enemies<2)|buff.trick_shots.remains>execute_time&active_enemies>1
actions.st+=/rapid_fire,if=focus+cast_regen<focus.max&(buff.trueshot.down|!runeforge.eagletalons_true_focus)&(buff.double_tap.down|talent.streamline)
actions.st+=/chimaera_shot,if=buff.precise_shots.up|focus>cost+action.aimed_shot.cost
actions.st+=/arcane_shot,if=buff.precise_shots.up|focus>cost+action.aimed_shot.cost
actions.st+=/serpent_sting,target_if=min:remains,if=refreshable&target.time_to_die>duration
actions.st+=/barrage,if=active_enemies>1
actions.st+=/rapid_fire,if=focus+cast_regen<focus.max&(buff.double_tap.down|talent.streamline)
actions.st+=/steady_shot

actions.trickshots=steady_shot,if=talent.steady_focus&in_flight&buff.steady_focus.remains<5
actions.trickshots+=/double_tap,if=covenant.kyrian&cooldown.resonating_arrow.remains<gcd|cooldown.rapid_fire.remains<cooldown.aimed_shot.full_recharge_time|!(talent.streamline&runeforge.surging_shots)|!covenant.kyrian
actions.trickshots+=/tar_trap,if=runeforge.soulforge_embers&tar_trap.remains<gcd&cooldown.flare.remains<gcd
actions.trickshots+=/flare,if=tar_trap.up&runeforge.soulforge_embers
actions.trickshots+=/explosive_shot
actions.trickshots+=/wild_spirits
actions.trickshots+=/resonating_arrow
actions.trickshots+=/volley
actions.trickshots+=/barrage
actions.trickshots+=/trueshot
actions.trickshots+=/rapid_fire,if=buff.trick_shots.remains>=execute_time&runeforge.surging_shots&buff.double_tap.down
actions.trickshots+=/aimed_shot,target_if=min:(dot.serpent_sting.remains<?action.serpent_sting.in_flight_to_target*dot.serpent_sting.duration),if=buff.trick_shots.remains>=execute_time&(buff.precise_shots.down|full_recharge_time<cast_time+gcd|buff.trueshot.up)
actions.trickshots+=/death_chakram,if=focus+cast_regen<focus.max
actions.trickshots+=/rapid_fire,if=buff.trick_shots.remains>=execute_time
actions.trickshots+=/multishot,if=buff.trick_shots.down|buff.precise_shots.up&focus>cost+action.aimed_shot.cost&(!talent.chimaera_shot|active_enemies>3)
actions.trickshots+=/chimaera_shot,if=buff.precise_shots.up&focus>cost+action.aimed_shot.cost&active_enemies<4
actions.trickshots+=/kill_shot,if=buff.dead_eye.down
actions.trickshots+=/a_murder_of_crows
actions.trickshots+=/flayed_shot
actions.trickshots+=/serpent_sting,target_if=min:dot.serpent_sting.remains,if=refreshable
actions.trickshots+=/multishot,if=focus>cost+action.aimed_shot.cost
actions.trickshots+=/steady_shot

head=helm_of_insatiable_appetite,id=183001,bonus_id=7188/1485,ilevel=213
neck=nobles_birthstone_pendant,id=183039,bonus_id=7188/1485,ilevel=213
shoulders=boneshatter_pauldrons,id=172327,bonus_id=7013,ilevel=235
back=crest_of_the_legionnaire_general,id=183032,bonus_id=6805,ilevel=220
chest=master_huntsmans_bandolier,id=182988,bonus_id=6805,ilevel=213,enchant=eternal_skirmish
wrists=bangles_of_errant_pride,id=182977,bonus_id=6805,ilevel=213
hands=oathsworn_soldiers_gauntlets,id=182991,bonus_id=6805,ilevel=220
waist=loadbearing_belt,id=183016,bonus_id=6805,ilevel=213
legs=greaves_of_enigmatic_energies,id=183012,bonus_id=6805,ilevel=213
feet=stoneclas_stompers,id=183006,bonus_id=6805,ilevel=213,enchant=15agility
finger1=most_regal_signet_of_sire_denathrius,id=183036,bonus_id=6805,ilevel=220,enchant=16crit
finger2=ritualists_treasured_ring,id=183037,bonus_id=6805,ilevel=213,enchant=16crit
trinket1=dreadfire_vessel,id=184030,bonus_id=6805,ilevel=220,enchant=shadowcore_oil
trinket2=stone_legion_heraldry,id=184027,bonus_id=6805,ilevel=220
main_hand=deadeye_blunderbuss,id=184250,bonus_id=6805,ilevel=220,enchant=sinful_revelation

# Gear Summary
# gear_ilvl=217.27
# gear_agility=789
# gear_stamina=1300
# gear_crit_rating=443
# gear_haste_rating=604
# gear_mastery_rating=504
# gear_versatility_rating=54
# gear_armor=818

soulforge_embers : 12170 dps, 3918 dps to main target

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
12170.0 12170.0 18.1 / 0.149% 1239.3 / 10.2% 1264.0
RPS Out RPS In Primary Resource Waiting APM Active Skill
9.6 9.4 Focus 0.00% 47.7 100.0% 100%
Talents
Night Fae
Runeforge

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
soulforge_embers 12170
Aimed Shot 3595 (3944) 29.5% (32.4%) 46.4 6.40sec 25451 16417 Direct 231.8 (253.7) 3787 7565 4646 22.7% (22.7%)

Stats Details: Aimed Shot

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 46.40 231.75 0.00 0.00 1.5503 0.0000 1076728.36 1537998.79 29.99% 16416.56 16416.56
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 77.25% 179.04 127 234 3786.67 2524 9967 3789.09 3548 4063 677961 968399 29.99%
crit 22.75% 52.72 26 83 7564.50 5048 19934 7570.38 6453 9578 398768 569600 29.99%

Action Details: Aimed Shot

  • id:19434
  • school:physical
  • range:40.0
  • travel_speed:100.0000
  • radius:8.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:12.000
  • cooldown hasted:true
  • base_recharge_multiplier:1.000
  • base_execute_time:2.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:focus
  • base_cost:35.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:19434
  • name:Aimed Shot
  • school:physical
  • tooltip:
  • description:A powerful aimed shot that deals {$s1=0} Physical damage.

Action Priority List

    trickshots
    [L]:46.58
  • if_expr:buff.trick_shots.remains>=execute_time&(buff.precise_shots.down|full_recharge_time<cast_time+gcd|buff.trueshot.up)
  • target_if_expr:(dot.serpent_sting.remains<?action.serpent_sting.in_flight_to_target*dot.serpent_sting.duration)
    Aimed Shot (_double_tap) 349 2.9% 0.0 0.00sec 0 0 Direct 21.9 3879 7731 4753 22.7%

Stats Details: Aimed Shot Double Tap

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 0.00 21.92 0.00 0.00 0.0000 0.0000 104229.39 148881.27 29.99% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 77.28% 16.94 5 32 3879.14 2524 9967 3914.76 2960 5642 65729 93887 29.99%
crit 22.72% 4.98 0 14 7731.27 5048 19934 7714.97 0 18806 38501 54994 29.70%

Action Details: Aimed Shot Double Tap

  • id:19434
  • school:physical
  • range:40.0
  • travel_speed:100.0000
  • radius:8.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:12.000
  • cooldown hasted:true
  • base_recharge_multiplier:1.000
  • base_execute_time:2.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:focus
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:19434
  • name:Aimed Shot
  • school:physical
  • tooltip:
  • description:A powerful aimed shot that deals {$s1=0} Physical damage.
Auto Shot 377 3.1% 113.5 2.65sec 994 437 Direct 113.3 812 1623 996 22.7%

Stats Details: Auto Shot

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 113.54 113.31 0.00 0.00 2.2773 0.0000 112909.61 161280.09 29.99% 436.68 436.68
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 77.29% 87.57 60 115 812.13 774 1019 812.12 797 828 71125 101595 29.99%
crit 22.71% 25.74 11 44 1623.43 1548 2037 1623.31 1560 1712 41785 59685 29.99%

Action Details: Auto Shot

  • id:75
  • school:physical
  • range:40.0
  • travel_speed:60.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00

Spelldata

  • id:75
  • name:Auto Shot
  • school:physical
  • tooltip:Firing at the target.
  • description:Automatically shoots the target until cancelled.
Dreadfire Vessel 138 1.1% 3.7 90.79sec 11061 0 Direct 3.7 9038 18075 11094 22.7%

Stats Details: Dreadfire Vessel

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 3.73 3.72 0.00 0.00 0.0000 0.0000 41273.40 41273.40 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 77.31% 2.88 0 4 9037.95 8937 9474 8983.66 0 9474 26006 26006 0.00%
crit 22.69% 0.84 0 4 18074.78 17875 18947 11107.62 0 18947 15267 15267 0.00%

Action Details: Dreadfire Vessel

  • id:344732
  • school:fire
  • range:50.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:90.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:8212.26
  • base_dd_max:8212.26
  • base_dd_mult:1.00

Spelldata

  • id:344732
  • name:Dreadfire Vessel
  • school:fire
  • tooltip:
  • description:Unleash incendiary flames at your target inflicting {$s1=0} Fire damage.
Eternal Skirmish 39 0.3% 21.7 13.52sec 546 0 Direct 21.7 446 892 546 22.4%

Stats Details: Eternal Skirmish

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 21.66 21.66 0.00 0.00 0.0000 0.0000 11827.63 11827.63 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 77.60% 16.81 5 31 445.93 435 485 445.92 435 458 7496 7496 0.00%
crit 22.40% 4.85 0 13 892.42 871 969 885.63 0 969 4332 4332 0.00%

Action Details: Eternal Skirmish

  • id:323889
  • school:shadow
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:400.00
  • base_dd_max:400.00
  • base_dd_mult:1.00

Spelldata

  • id:323889
  • name:Eternal Skirmish
  • school:shadow
  • tooltip:
  • description:Deals {$s1=400} Shadow damage.
Kill Shot 75 0.6% 4.2 14.55sec 5429 4505 Direct 4.1 4246 9557 5464 23.0%

Stats Details: Kill Shot

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 4.17 4.14 0.00 0.00 1.2052 0.0000 22621.06 32311.92 29.99% 4505.29 4505.29
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 77.00% 3.19 0 6 4245.74 4065 4838 4224.57 0 4796 13528 19323 29.87%
crit 23.00% 0.95 0 4 9557.44 9146 10885 6163.31 0 10885 9093 12989 19.35%

Action Details: Kill Shot

  • id:53351
  • school:physical
  • range:40.0
  • travel_speed:80.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:10.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:focus
  • base_cost:10.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:53351
  • name:Kill Shot
  • school:physical
  • tooltip:
  • description:You attempt to finish off a wounded target, dealing {$s1=0} Physical damage. Only usable on enemies with less than {$s2=20}% health.

Action Priority List

    trickshots
    [O]:4.17
  • if_expr:buff.dead_eye.down
Master Marksman 464 3.8% 290.5 1.05sec 479 0 Periodic 502.5 277 0 277 0.0% 67.0%

Stats Details: Master Marksman

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 290.49 0.00 502.52 502.52 0.0000 2.0000 139013.13 139013.13 0.00% 138.32 0.00
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 100.00% 502.52 367 639 276.54 37 2462 276.79 226 338 139013 139013 0.00%

Action Details: Master Marksman

  • id:269576
  • school:physical
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:false
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:6.00
  • base_tick_time:2.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH

Spelldata

  • id:269576
  • name:Master Marksman
  • school:physical
  • tooltip:Bleeding for $w1 damage every $t1 sec.
  • description:{$@spelldesc260309=Your ranged special attack critical strikes cause the target to bleed for an additional {$s1=15}% of the damage dealt over {$269576d=6 seconds}.}
Multi-Shot 2556 21.0% 76.3 3.91sec 10043 8787 Direct 380.5 1642 3284 2013 22.6%

Stats Details: Multishot

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 76.30 380.51 0.00 0.00 1.1429 0.0000 766246.54 1094506.55 29.99% 8787.23 8787.23
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 77.39% 294.49 219 375 1641.96 953 2194 1642.29 1525 1722 483686 690897 29.99%
crit 22.61% 86.01 49 126 3284.06 1905 4389 3285.17 2941 3533 282561 403610 29.99%

Action Details: Multishot

  • id:257620
  • school:physical
  • range:40.0
  • travel_speed:50.0000
  • radius:10.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:5
  • harmful:true

Resources

  • resource:focus
  • base_cost:20.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:257620
  • name:Multi-Shot
  • school:physical
  • tooltip:
  • description:Fires several missiles, hitting your current target and up to $I enemies within $A1 yards for {$s1=0} Physical damage.

Action Priority List

    trickshots
    [N]:71.38
  • if_expr:buff.trick_shots.down|buff.precise_shots.up&focus>cost+action.aimed_shot.cost&(!talent.chimaera_shot|active_enemies>3)
    trickshots
    [P]:4.91
  • if_expr:focus>cost+action.aimed_shot.cost
Rapid Fire 1069 8.8% 15.8 19.11sec 20267 11500 Periodic 589.5 443 887 543 22.6% 1.6%

Stats Details: Rapid Fire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 15.80 0.00 118.28 589.54 1.7623 0.2017 320255.69 457453.23 29.99% 11500.13 11500.13
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 77.37% 456.14 292 613 442.70 351 925 442.64 427 461 201922 288425 29.99%
crit 22.63% 133.40 85 197 886.93 703 1850 887.01 812 986 118334 169028 29.99%

Action Details: Rapid Fire

  • id:257044
  • school:physical
  • range:40.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:20.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:false
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:2.00
  • base_tick_time:0.33
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH

Spelldata

  • id:257044
  • name:Rapid Fire
  • school:physical
  • tooltip:Being targeted by Rapid Fire.
  • description:Shoot a stream of {$s1=7} shots at your target over {$d=2 seconds}, dealing a total of ${$m1*$257045sw1} Physical damage. {$?s321281=true}[ Each shot generates {$263585s1=1} Focus.][] Usable while moving.

Action Details: Rapid Fire Damage

  • id:257045
  • school:physical
  • range:40.0
  • travel_speed:40.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:on_hit
  • energize_resource:focus
  • energize_amount:1.0

Spelldata

  • id:257045
  • name:Rapid Fire
  • school:physical
  • tooltip:
  • description:{$@spelldesc257044=Shoot a stream of {$s1=7} shots at your target over {$d=2 seconds}, dealing a total of ${$m1*$257045sw1} Physical damage. {$?s321281=true}[ Each shot generates {$263585s1=1} Focus.][] Usable while moving.}

Action Priority List

    trickshots
    [M]:15.81
  • if_expr:buff.trick_shots.remains>=execute_time
Shadowcore Oil Blast 44 0.4% 43.5 6.98sec 300 0 Direct 43.5 245 491 300 22.3%

Stats Details: Shadowcore Oil Blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 43.49 43.49 0.00 0.00 0.0000 0.0000 13054.81 13054.81 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 77.67% 33.78 17 62 245.36 239 266 245.37 241 250 8287 8287 0.00%
crit 22.33% 9.71 2 21 490.95 479 533 490.94 479 512 4767 4767 0.00%

Action Details: Shadowcore Oil Blast

  • id:336463
  • school:shadow
  • range:60.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:220.00
  • base_dd_max:220.00
  • base_dd_mult:1.00

Spelldata

  • id:336463
  • name:Shadowcore Oil Blast
  • school:shadow
  • tooltip:
  • description:Deals {$s1=220} Shadow damage.
Soulforge Embers 1902 15.6% 14.4 21.46sec 39644 0 Periodic 582.2 798 1597 979 22.7% 56.3%

Stats Details: Soulforge Embers

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 14.38 0.00 582.21 582.21 0.0000 1.4500 570168.43 570168.43 0.00% 675.39 0.00
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 77.31% 450.08 335 567 798.03 81 1058 798.18 778 815 359199 359199 0.00%
crit 22.69% 132.13 83 190 1596.54 162 2115 1596.85 1525 1666 210969 210969 0.00%

Action Details: Soulforge Embers

  • id:336746
  • school:fire
  • range:100.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:5
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.400000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:12.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH

Spelldata

  • id:336746
  • name:Soulforge Embers
  • school:fire
  • tooltip:Burning for $w1 Fire damage every $t1 sec.
  • description:{$@spelldesc336745=Launching a Flare into your Tar Trap causes up to {$s1=5} enemies inside of the Tar Trap to burn for $336746o Fire damage over {$331269d=12 seconds}.}
Steady Shot 287 2.4% 54.7 5.43sec 1574 1161 Direct 55.6 1264 2528 1547 22.4%

Stats Details: Steady Shot

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 54.65 55.57 0.00 0.00 1.3556 0.0000 85997.84 122839.31 29.99% 1160.75 1160.75
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 77.59% 43.12 27 60 1264.09 1219 1605 1263.93 1230 1300 54513 77867 29.99%
crit 22.41% 12.45 3 27 2528.47 2439 3210 2527.46 2439 2703 31484 44972 29.99%

Action Details: Steady Shot

  • id:56641
  • school:physical
  • range:40.0
  • travel_speed:75.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:1.75
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:on_cast
  • energize_resource:focus
  • energize_amount:10.0

Spelldata

  • id:56641
  • name:Steady Shot
  • school:physical
  • tooltip:
  • description:A steady shot that causes {$s1=0} Physical damage. Usable while moving.{$?s321018=true}[ |cFFFFFFFFGenerates {$s2=0} Focus.][]

Action Priority List

    trickshots
    [F]:16.72
  • if_expr:talent.steady_focus&in_flight&buff.steady_focus.remains<5
    trickshots
    [Q]:38.14
Wild Spirits 46 (1275) 0.4% (10.4%) 3.0 120.66sec 127505 115585 Direct 14.8 (212.4) 749 1497 919 22.8% (22.7%)

Stats Details: Wild Spirits

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.98 14.85 0.00 0.00 1.1032 0.0000 13649.77 13649.77 0.00% 115584.79 115584.79
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 77.24% 11.47 4 15 749.03 726 823 748.89 726 780 8589 8589 0.00%
crit 22.76% 3.38 0 10 1497.46 1452 1645 1460.79 0 1645 5060 5060 0.00%

Action Details: Wild Spirits

  • id:328231
  • school:nature
  • range:40.0
  • travel_speed:30.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:120.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:328231
  • name:Wild Spirits
  • school:nature
  • tooltip:
  • description:Evoke the energy of Wild Spirits at the target location, dealing {$328837s3=0} Nature damage and apply Hunter's Mark to all enemy targets within the area for {$328837d=15 seconds}. While the Wild Spirits are active, each damaging ability you or your pet use against a target in the area will strike up to $328757I nearby targets for {$328757s1=0} Nature damage.

Action Details: Wild Spirits Damage

  • id:328837
  • school:nature
  • range:100.0
  • travel_speed:0.0000
  • radius:12.0
  • trigger_gcd:0.0000
  • gcd_type:attack_haste
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:328837
  • name:Wild Spirits
  • school:nature
  • tooltip:
  • description:{$@spelldesc328231=Evoke the energy of Wild Spirits at the target location, dealing {$328837s3=0} Nature damage and apply Hunter's Mark to all enemy targets within the area for {$328837d=15 seconds}. While the Wild Spirits are active, each damaging ability you or your pet use against a target in the area will strike up to $328757I nearby targets for {$328757s1=0} Nature damage.}

Action Priority List

    trickshots
    [J]:2.98
    Wild Spirits (_proc) 1229 10.0% 39.5 6.53sec 9263 0 Direct 197.5 1510 3020 1852 22.7%

Stats Details: Wild Spirits Proc

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 39.51 197.53 0.00 0.00 0.0000 0.0000 365930.68 365930.68 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 77.30% 152.69 99 181 1509.66 1355 1699 1510.25 1489 1555 230511 230511 0.00%
crit 22.70% 44.84 23 66 3020.11 2711 3398 3021.18 2924 3138 135419 135419 0.00%

Action Details: Wild Spirits Proc

  • id:328757
  • school:nature
  • range:40.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:attack_haste
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:5
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:328757
  • name:Wild Spirits
  • school:nature
  • tooltip:
  • description:{$@spelldesc328231=Evoke the energy of Wild Spirits at the target location, dealing {$328837s3=0} Nature damage and apply Hunter's Mark to all enemy targets within the area for {$328837d=15 seconds}. While the Wild Spirits are active, each damaging ability you or your pet use against a target in the area will strike up to $328757I nearby targets for {$328757s1=0} Nature damage.}
Simple Action Stats Execute Interval
soulforge_embers
Veiled Augmentation (augmentation) 1.0 0.00sec

Stats Details: Augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Augmentation

  • id:347901
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:soulforge_embers
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Blood Fury 3.0 120.66sec

Stats Details: Blood Fury

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.96 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Blood Fury

  • id:20572
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:120.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:20572
  • name:Blood Fury
  • school:physical
  • tooltip:Attack power increased by $w1.
  • description:Increases your attack power by {$s1=122} for {$d=15 seconds}.

Action Priority List

    cds
    [D]:2.97
  • if_expr:buff.trueshot.up|target.time_to_die<16
Double Tap 5.6 60.54sec

Stats Details: Double Tap

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 5.60 0.00 0.00 0.00 0.9781 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Double Tap

  • id:260402
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:60.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:260402
  • name:Double Tap
  • school:physical
  • tooltip:Your next Aimed Shot will fire a second time instantly at {$s4=100}% power and consume no Focus, or your next Rapid Fire will shoot {$s3=100}% additional shots during its channel.
  • description:Your next Aimed Shot will fire a second time instantly at {$s4=100}% power without consuming Focus, or your next Rapid Fire will shoot {$s3=100}% additional shots during its channel.

Action Priority List

    trickshots
    [G]:4.61
  • if_expr:covenant.kyrian&cooldown.resonating_arrow.remains<gcd|cooldown.rapid_fire.remains<cooldown.aimed_shot.full_recharge_time|!(talent.streamline&runeforge.surging_shots)|!covenant.kyrian
Flare 14.4 21.46sec

Stats Details: Flare

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 14.38 0.00 0.00 0.00 1.1533 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Flare

  • id:1543
  • school:arcane
  • range:40.0
  • travel_speed:25.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:20.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:1543
  • name:Flare
  • school:arcane
  • tooltip:
  • description:Exposes all hidden and invisible enemies within the targeted area for $m1 sec.

Action Priority List

    trickshots
    [I]:14.38
  • if_expr:tar_trap.up&runeforge.soulforge_embers
Spectral Flask of Power (flask) 1.0 0.00sec

Stats Details: Flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Flask

  • id:307185
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:soulforge_embers
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Feast of Gluttonous Hedonism (food) 1.0 0.00sec

Stats Details: Food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Food

  • id:308462
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:soulforge_embers
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Potion of Spectral Agility (potion) 1.5 309.33sec

Stats Details: Potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.47 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Potion

  • id:307159
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:300.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Action Priority List

    cds
    [E]:1.47
  • if_expr:buff.trueshot.up&buff.bloodlust.up|buff.trueshot.up&target.health.pct<20|target.time_to_die<26
Tar Trap 7.5 43.11sec

Stats Details: Tar Trap

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 7.49 0.00 0.00 0.00 1.0323 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Tar Trap

  • id:187698
  • school:physical
  • range:40.0
  • travel_speed:20.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:25.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:187698
  • name:Tar Trap
  • school:physical
  • tooltip:
  • description:Hurls a tar trap to the target location that creates a {$187699s1=8} yd radius pool of tar around itself for {$13810d=30 seconds} when the first enemy approaches. All enemies have {$135299s1=50}% reduced movement speed while in the area of effect. Trap will exist for {$13809d=60 seconds}.

Action Priority List

    trickshots
    [H]:6.48
  • if_expr:runeforge.soulforge_embers&tar_trap.remains<gcd&cooldown.flare.remains<gcd
Trueshot 3.0 120.67sec

Stats Details: Trueshot

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.96 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Trueshot

  • id:288613
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:attack_haste
  • min_gcd:0.0000
  • cooldown:120.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:288613
  • name:Trueshot
  • school:physical
  • tooltip:The cooldown of Aimed Shot and Rapid Fire is reduced by ${$m1/4}%, and Aimed Shot casts {$s4=50}% faster. All Focus generation is increased by {$s5=50}%.
  • description:Reduces the cooldown of your Aimed Shot and Rapid Fire by ${$m1/4}%, and causes Aimed Shot to cast {$s4=50}% faster for {$d=15 seconds}. While Trueshot is active, you generate {$s5=50}% additional Focus.

Action Priority List

    trickshots
    [K]:2.96

Buffs

Dynamic Buffs Start Refresh Interval Trigger Avg Dur Up-Time Benefit Overflow Expiry
Blood Fury 3.0 0.0 120.7sec 120.7sec 14.7sec 14.60% 0.00% 0.0 (0.0) 2.8

Buff Details

  • buff initial source:soulforge_embers
  • cooldown name:buff_blood_fury
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:120.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:attack_power
  • amount:122.00

Trigger Details

  • interval_min/max:120.0s / 123.7s
  • trigger_min/max:120.0s / 123.7s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 15.0s

Stack Uptimes

  • blood_fury_1:14.60%

Spelldata

  • id:20572
  • name:Blood Fury
  • tooltip:Attack power increased by $w1.
  • description:Increases your attack power by {$s1=122} for {$d=15 seconds}.
  • max_stacks:0
  • duration:15.00
  • cooldown:120.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 40.0sec 13.52% 0.00% 0.0 (0.0) 1.0

Buff Details

  • buff initial source:soulforge_embers
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • base duration:40.00
  • duration modifier:1.00
  • base cooldown:300.00
  • default_chance:100.00%
  • default_value:0.30
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:40.0s / 40.0s

Stack Uptimes

  • bloodlust_1:13.52%

Spelldata

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by $w1%.
  • description:Increases haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Double Tap 5.6 0.0 58.4sec 60.6sec 4.6sec 8.70% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:soulforge_embers
  • cooldown name:buff_double_tap
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.50
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:50.0s / 62.7s
  • trigger_min/max:60.0s / 62.7s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 13.3s

Stack Uptimes

  • double_tap_1:8.70%

Spelldata

  • id:260402
  • name:Double Tap
  • tooltip:Your next Aimed Shot will fire a second time instantly at {$s4=100}% power and consume no Focus, or your next Rapid Fire will shoot {$s3=100}% additional shots during its channel.
  • description:Your next Aimed Shot will fire a second time instantly at {$s4=100}% power without consuming Focus, or your next Rapid Fire will shoot {$s3=100}% additional shots during its channel.
  • max_stacks:0
  • duration:15.00
  • cooldown:60.00
  • default_chance:0.00%
Well Fed (feast_of_gluttonous_hedonism) 1.0 0.0 0.0sec 0.0sec 300.0sec 100.00% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:soulforge_embers
  • cooldown name:buff_feast_of_gluttonous_hedonism
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:agility
  • amount:20.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:240.1s / 359.8s

Stack Uptimes

  • feast_of_gluttonous_hedonism_1:100.00%

Spelldata

  • id:327709
  • name:Well Fed
  • tooltip:Agility increased by $w1.
  • description:Agility increased by {$s1=20}. Lasts {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Lock and Load 8.9 0.3 30.7sec 29.7sec 2.1sec 6.23% 18.72% 0.3 (0.3) 0.0

Buff Details

  • buff initial source:soulforge_embers
  • cooldown name:buff_lock_and_load
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:8.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:1.8s / 260.9s
  • trigger_min/max:1.8s / 260.9s
  • trigger_pct:8.05%
  • duration_min/max:0.0s / 12.6s

Stack Uptimes

  • lock_and_load_1:6.23%

Spelldata

  • id:194594
  • name:Lock and Load
  • tooltip:Aimed Shot costs no Focus and is instant.
  • description:{$@spelldesc194595=Your ranged auto attacks have a {$194595h=8}% chance to trigger Lock and Load, causing your next Aimed Shot to cost no Focus and be instant.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%

Trigger Spelldata

  • id:194595
  • name:Lock and Load
  • tooltip:
  • description:Your ranged auto attacks have a {$194595h=8}% chance to trigger Lock and Load, causing your next Aimed Shot to cost no Focus and be instant.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:8.00%
Potion of Spectral Agility 1.5 0.0 308.8sec 308.8sec 23.2sec 11.19% 0.00% 0.0 (0.0) 1.2

Buff Details

  • buff initial source:soulforge_embers
  • cooldown name:buff_potion_of_spectral_agility
  • max_stacks:1
  • base duration:25.00
  • duration modifier:1.00
  • base cooldown:1.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:agility
  • amount:190.00

Trigger Details

  • interval_min/max:300.0s / 331.5s
  • trigger_min/max:300.0s / 331.5s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 25.0s

Stack Uptimes

  • potion_of_spectral_agility_1:11.19%

Spelldata

  • id:307159
  • name:Potion of Spectral Agility
  • tooltip:Agility increased by $w1.
  • description:Increases your Agility by {$s1=190} for {$d=25 seconds}.
  • max_stacks:0
  • duration:25.00
  • cooldown:1.00
  • default_chance:0.00%
Precise Shots 38.3 8.1 7.8sec 6.4sec 3.2sec 41.49% 85.28% 4.1 (4.1) 0.0

Buff Details

  • buff initial source:soulforge_embers
  • cooldown name:buff_precise_shots
  • max_stacks:2
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.50
  • default_chance:101.00%
  • default_value:0.75
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.9s / 39.8s
  • trigger_min/max:0.9s / 15.5s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 32.5s

Stack Uptimes

  • precise_shots_1:34.83%
  • precise_shots_2:6.66%

Spelldata

  • id:260242
  • name:Precise Shots
  • tooltip:Damage of {$?s342049=false}[Chimaera Shot][Arcane Shot] or Multi-Shot increased by {$s1=75}%.
  • description:{$@spelldesc260240=Aimed Shot causes your next 1-{$260242u=2} {$?s342049=false}[Chimaera Shots][Arcane Shots] or Multi-Shots to deal {$260242s1=75}% more damage.}
  • max_stacks:2
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
Spectral Flask of Power 1.0 0.0 0.0sec 0.0sec 300.0sec 100.00% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:soulforge_embers
  • cooldown name:buff_spectral_flask_of_power
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:agility
  • amount:70.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:240.1s / 359.8s

Stack Uptimes

  • spectral_flask_of_power_1:100.00%

Spelldata

  • id:307185
  • name:Spectral Flask of Power
  • tooltip:$pri increased by $w1.
  • description:Increases $pri by {$s1=70} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Steady Focus 9.1 12.0 34.7sec 14.4sec 29.0sec 87.71% 0.00% 12.0 (12.0) 8.2

Buff Details

  • buff initial source:soulforge_embers
  • cooldown name:buff_steady_focus
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.07
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:15.0s / 206.2s
  • trigger_min/max:4.0s / 48.3s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 205.2s

Stack Uptimes

  • steady_focus_1:87.71%

Spelldata

  • id:193534
  • name:Steady Focus
  • tooltip:Haste increased by {$s1=7}%.
  • description:{$@spelldesc193533=Using Steady Shot twice in a row increases your Haste by {$193534s1=7}% for {$193534d=15 seconds}.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%

Trigger Spelldata

  • id:193533
  • name:Steady Focus
  • tooltip:
  • description:Using Steady Shot twice in a row increases your Haste by {$193534s1=7}% for {$193534d=15 seconds}.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
Trick Shots 63.0 13.3 4.7sec 3.9sec 4.1sec 85.90% 100.00% 13.3 (13.3) 0.0

Buff Details

  • buff initial source:soulforge_embers
  • cooldown name:buff_trick_shots
  • max_stacks:1
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:1.8s / 13.4s
  • trigger_min/max:0.9s / 12.1s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 13.3s

Stack Uptimes

  • trick_shots_1:85.90%

Spelldata

  • id:257622
  • name:Trick Shots
  • tooltip:Your next Aimed Shot or Rapid Fire will ricochet and hit {$257621s1=5} additional targets for {$257621s4=50}% of normal damage.
  • description:{$@spelldesc257621=When Multi-Shot hits {$s2=3} or more targets, your next Aimed Shot or Rapid Fire will ricochet and hit up to {$s1=5} additional targets for {$s4=50}% of normal damage.}
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
Trueshot 3.0 0.0 120.7sec 120.7sec 19.1sec 18.94% 0.00% 0.0 (0.0) 2.8

Buff Details

  • buff initial source:soulforge_embers
  • cooldown name:buff_trueshot
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.31
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.50
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:120.0s / 123.7s
  • trigger_min/max:120.0s / 123.7s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 19.7s

Stack Uptimes

  • trueshot_1:18.94%

Spelldata

  • id:288613
  • name:Trueshot
  • tooltip:The cooldown of Aimed Shot and Rapid Fire is reduced by ${$m1/4}%, and Aimed Shot casts {$s4=50}% faster. All Focus generation is increased by {$s5=50}%.
  • description:Reduces the cooldown of your Aimed Shot and Rapid Fire by ${$m1/4}%, and causes Aimed Shot to cast {$s4=50}% faster for {$d=15 seconds}. While Trueshot is active, you generate {$s5=50}% additional Focus.
  • max_stacks:0
  • duration:15.00
  • cooldown:120.00
  • default_chance:0.00%
Veiled Augmentation 1.0 0.0 0.0sec 0.0sec 300.0sec 100.00% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:soulforge_embers
  • cooldown name:buff_veiled_augmentation
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:agility
  • amount:18.00
  • stat:strength
  • amount:18.00
  • stat:intellect
  • amount:18.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:240.1s / 359.8s

Stack Uptimes

  • veiled_augmentation_1:100.00%

Spelldata

  • id:347901
  • name:Veiled Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=18} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Wild Spirits 3.0 0.0 120.7sec 120.7sec 17.5sec 17.43% 0.00% 0.0 (0.0) 2.8

Buff Details

  • buff initial source:soulforge_embers
  • cooldown name:buff_wild_spirits
  • max_stacks:1
  • base duration:18.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:120.0s / 123.4s
  • trigger_min/max:120.0s / 123.4s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 18.0s

Stack Uptimes

  • wild_spirits_1:17.43%

Spelldata

  • id:328837
  • name:Wild Spirits
  • tooltip:
  • description:{$@spelldesc328231=Evoke the energy of Wild Spirits at the target location, dealing {$328837s3=0} Nature damage and apply Hunter's Mark to all enemy targets within the area for {$328837d=15 seconds}. While the Wild Spirits are active, each damaging ability you or your pet use against a target in the area will strike up to $328757I nearby targets for {$328757s1=0} Nature damage.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
Windfury Totem 1.0 0.0 0.0sec 0.0sec 300.0sec 100.00% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:soulforge_embers
  • cooldown name:buff_windfury_totem
  • max_stacks:1
  • base duration:900.00
  • duration modifier:1.00
  • base cooldown:0.50
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:240.1s / 359.8s

Stack Uptimes

  • windfury_totem_1:100.00%

Spelldata

  • id:327942
  • name:Windfury Totem
  • tooltip:Your auto-attacks have a {$h=10}% chance to instantly attack again.
  • description:{$@spelldesc8512=Summons a Windfury Totem with {$s1=5} health at the feet of the caster for {$d=120 seconds}. Party members within {$s2=30} yds have a {$327942h=10}% chance when they auto-attack to swing an extra time.}
  • max_stacks:0
  • duration:120.00
  • cooldown:0.00
  • default_chance:10.00%
Constant Buffs
Arcane Intellect

Buff Details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff Details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:15.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
Power Word: Fortitude

Buff Details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.$?$w2>0[ Magic damage taken reduced by $w2%.][]
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Procs, Uptimes & Benefits

Proc Count Min Max Interval Min Max
double_tap_aimed 4.4 1.0 7.0 74.0s 46.2s 292.9s
double_tap_rapid_fire 1.1 0.0 4.0 101.4s 55.7s 246.1s
Uptime Avg % Min Max Avg Dur Min Max
Focus Cap 1.27% 0.92% 2.96% 1.0s 0.0s 3.6s

Cooldown waste details

Seconds per ExecuteSeconds per Iteration
AbilityAverageMinimumMaximumAverageMinimumMaximum
Tar Trap17.89516.19423.221116.06783.885150.030
Double Tap0.7310.0012.6562.7940.0007.609
Aimed Shot1.4780.0018.19016.0224.66231.884
Kill Shot5.0180.00136.96114.5270.00036.961
Flare1.6550.0015.99019.11910.30730.013
Wild Spirits0.8160.0013.3971.3570.0005.182
Trueshot0.8150.0013.7171.3670.0005.333
Rapid Fire3.6300.00125.12548.49518.18679.497

Resources

Gains Type Count Total Tot% Avg Overflow Ovr%
soulforge_embers
steady_shot Focus 55.64 536.39 19.02% 9.64 20.04 3.60%
rapid_fire Focus 118.35 117.84 4.18% 1.00 0.51 0.43%
focus_regen Focus 610.95 1925.99 68.29% 3.15 30.15 1.54%
Trueshot Focus 182.09 240.27 8.52% 1.32 2.33 0.96%
Change Start Gain/s Loss/s Overflow (Total) End (Avg) Min Max
Focus 100.0 9.40 9.61 53.1 37.5 0.1 100.0
Usage Type Count Total Avg RPE APR
soulforge_embers
aimed_shot Focus 46.4 1315.3 28.4 28.3 897.9
kill_shot Focus 4.2 41.7 10.0 10.0 542.9
multishot Focus 76.3 1526.0 20.0 20.0 502.1

Statistics & Data Analysis

Fight Length
soulforge_embers Fight Length
Count 1217
Mean 299.97
Minimum 240.10
Maximum 359.83
Spread ( max - min ) 119.74
Range [ ( max - min ) / 2 * 100% ] 19.96%
DPS
soulforge_embers Damage Per Second
Count 1217
Mean 12170.00
Minimum 11209.87
Maximum 13308.34
Spread ( max - min ) 2098.46
Range [ ( max - min ) / 2 * 100% ] 8.62%
Standard Deviation 322.5531
5th Percentile 11641.12
95th Percentile 12690.70
( 95th Percentile - 5th Percentile ) 1049.58
Mean Distribution
Standard Deviation 9.2460
95.00% Confidence Interval ( 12151.88 - 12188.12 )
Normalized 95.00% Confidence Interval ( 99.85% - 100.15% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 27
0.1% Error 2699
0.1 Scale Factor Error with Delta=300 889
0.05 Scale Factor Error with Delta=300 3553
0.01 Scale Factor Error with Delta=300 88815
Priority Target DPS
soulforge_embers Priority Target Damage Per Second
Count 1217
Mean 3918.14
Minimum 3540.74
Maximum 4385.53
Spread ( max - min ) 844.78
Range [ ( max - min ) / 2 * 100% ] 10.78%
Standard Deviation 126.2834
5th Percentile 3711.24
95th Percentile 4123.64
( 95th Percentile - 5th Percentile ) 412.39
Mean Distribution
Standard Deviation 3.6199
95.00% Confidence Interval ( 3911.04 - 3925.23 )
Normalized 95.00% Confidence Interval ( 99.82% - 100.18% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 40
0.1% Error 3991
0.1 Scale Factor Error with Delta=300 137
0.05 Scale Factor Error with Delta=300 545
0.01 Scale Factor Error with Delta=300 13614
DPS(e)
soulforge_embers Damage Per Second (Effective)
Count 1217
Mean 12170.00
Minimum 11209.87
Maximum 13308.34
Spread ( max - min ) 2098.46
Range [ ( max - min ) / 2 * 100% ] 8.62%
Damage
soulforge_embers Damage
Count 1217
Mean 3643906.34
Minimum 2803348.15
Maximum 4377875.78
Spread ( max - min ) 1574527.63
Range [ ( max - min ) / 2 * 100% ] 21.60%
DTPS
soulforge_embers Damage Taken Per Second
Count 1217
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
soulforge_embers Healing Per Second
Count 1217
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
soulforge_embers Healing Per Second (Effective)
Count 1217
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
soulforge_embers Heal
Count 1217
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
soulforge_embers Healing Taken Per Second
Count 1217
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
soulforge_embers Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
soulforge_embersTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
soulforge_embers Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask
1 0.00 augmentation
2 0.00 food
3 0.00 snapshot_stats
Snapshot raid buffed stats before combat begins and pre-potting is done.
4 0.00 tar_trap,if=runeforge.soulforge_embers
5 0.00 double_tap,precast_time=10,if=!covenant.kyrian&(!talent.volley|active_enemies<2)
6 0.00 aimed_shot,if=active_enemies<3
7 0.00 steady_shot,if=active_enemies>2
Default action list Executed every time the actor is available.
# count action,conditions
8 1.00 auto_shot
0.00 counter_shot,line_cd=30,if=runeforge.sephuzs_proclamation|soulbind.niyas_tools_poison|(conduit.reversal_of_fortune&!runeforge.sephuzs_proclamation)
9 3.73 use_items
A 0.00 call_action_list,name=cds
B 0.00 call_action_list,name=st,if=active_enemies<3
C 0.00 call_action_list,name=trickshots,if=active_enemies>2
actions.cds
# count action,conditions
0.00 berserking,if=buff.trueshot.up|target.time_to_die<13
D 2.97 blood_fury,if=buff.trueshot.up|target.time_to_die<16
0.00 ancestral_call,if=buff.trueshot.up|target.time_to_die<16
0.00 fireblood,if=buff.trueshot.up|target.time_to_die<9
0.00 lights_judgment,if=buff.trueshot.down
0.00 bag_of_tricks,if=buff.trueshot.down
E 1.47 potion,if=buff.trueshot.up&buff.bloodlust.up|buff.trueshot.up&target.health.pct<20|target.time_to_die<26
actions.trickshots
# count action,conditions
F 16.72 steady_shot,if=talent.steady_focus&in_flight&buff.steady_focus.remains<5
G 4.61 double_tap,if=covenant.kyrian&cooldown.resonating_arrow.remains<gcd|cooldown.rapid_fire.remains<cooldown.aimed_shot.full_recharge_time|!(talent.streamline&runeforge.surging_shots)|!covenant.kyrian
H 6.48 tar_trap,if=runeforge.soulforge_embers&tar_trap.remains<gcd&cooldown.flare.remains<gcd
I 14.38 flare,if=tar_trap.up&runeforge.soulforge_embers
0.00 explosive_shot
J 2.98 wild_spirits
0.00 resonating_arrow
0.00 volley
0.00 barrage
K 2.96 trueshot
0.00 rapid_fire,if=buff.trick_shots.remains>=execute_time&runeforge.surging_shots&buff.double_tap.down
L 46.58 aimed_shot,target_if=min:(dot.serpent_sting.remains<?action.serpent_sting.in_flight_to_target*dot.serpent_sting.duration),if=buff.trick_shots.remains>=execute_time&(buff.precise_shots.down|full_recharge_time<cast_time+gcd|buff.trueshot.up)
0.00 death_chakram,if=focus+cast_regen<focus.max
M 15.81 rapid_fire,if=buff.trick_shots.remains>=execute_time
N 71.38 multishot,if=buff.trick_shots.down|buff.precise_shots.up&focus>cost+action.aimed_shot.cost&(!talent.chimaera_shot|active_enemies>3)
0.00 chimaera_shot,if=buff.precise_shots.up&focus>cost+action.aimed_shot.cost&active_enemies<4
O 4.17 kill_shot,if=buff.dead_eye.down
0.00 a_murder_of_crows
0.00 flayed_shot
0.00 serpent_sting,target_if=min:dot.serpent_sting.remains,if=refreshable
P 4.91 multishot,if=focus>cost+action.aimed_shot.cost
Q 38.14 steady_shot

Sample Sequence

01245789FJIKDENLNLNLNLNLNMNLNQFLNLINMNQLNQFLNQQQLNQHPIMNLGNNLNQFLNQILNMNQFQLNQQNPHLINM9NQFLNQLNQLNQFIGLNMNLNQFJKDLNLNHLINMNLQFNLNMNQLNIQFNLNQNLNMNQFGHLINLNL9NQFLNMNQLINQFPPLNQQQMNLHNILNQFNLNQPLGNMNIQFLJKDNLNMNLQFNHLINLNMNQFL9NLQNQQINLNMNOQFGLNQQHLINOMNLNQFNOQLNQIQEFMNLNOQPPLNQFHOIMNL

Sample Sequence Table

Time List # Name Target Resources Buffs
Pre precombat 0 flask soulforge_embers 100.0/100: 100% focus
Pre precombat 1 augmentation soulforge_embers 100.0/100: 100% focus
Pre precombat 2 food soulforge_embers 100.0/100: 100% focus
Pre precombat 4 tar_trap Fluffy_Pillow 100.0/100: 100% focus
Pre precombat 5 double_tap Fluffy_Pillow 100.0/100: 100% focus
Pre precombat 7 steady_shot Fluffy_Pillow 100.0/100: 100% focus double_tap
0:00.000 default 8 auto_attack Fluffy_Pillow 100.0/100: 100% focus double_tap
0:00.000 default 9 use_items Fluffy_Pillow 100.0/100: 100% focus double_tap
0:00.000 trickshots F steady_shot Fluffy_Pillow 100.0/100: 100% focus double_tap
0:01.483 trickshots J wild_spirits Fluffy_Pillow 100.0/100: 100% focus bloodlust, double_tap, steady_focus
0:02.398 trickshots I flare Fluffy_Pillow 100.0/100: 100% focus bloodlust, double_tap, steady_focus
0:03.314 trickshots K trueshot Fluffy_Pillow 100.0/100: 100% focus bloodlust, double_tap, steady_focus, wild_spirits
0:03.314 cds D blood_fury Fluffy_Pillow 100.0/100: 100% focus bloodlust, double_tap, steady_focus, trueshot, wild_spirits
0:03.314 cds E potion Fluffy_Pillow 100.0/100: 100% focus bloodlust, blood_fury, double_tap, steady_focus, trueshot, wild_spirits
0:03.314 trickshots N multishot Fluffy_Pillow 100.0/100: 100% focus bloodlust, blood_fury, double_tap, steady_focus, trueshot, wild_spirits, potion_of_spectral_agility
0:04.230 trickshots L aimed_shot Fluffy_Pillow 91.3/100: 91% focus bloodlust, blood_fury, double_tap, steady_focus, trick_shots, trueshot, wild_spirits, potion_of_spectral_agility
0:05.146 trickshots N multishot Fluffy_Pillow 66.9/100: 67% focus bloodlust, blood_fury, precise_shots, steady_focus, trueshot, wild_spirits, potion_of_spectral_agility
0:06.061 trickshots L aimed_shot Fluffy_Pillow 58.2/100: 58% focus bloodlust, blood_fury, steady_focus, trick_shots, trueshot, wild_spirits, potion_of_spectral_agility
0:06.978 trickshots N multishot Fluffy_Pillow 34.5/100: 35% focus bloodlust, blood_fury, lock_and_load, precise_shots(2), steady_focus, trueshot, wild_spirits, potion_of_spectral_agility
0:07.896 trickshots L aimed_shot Fluffy_Pillow 25.9/100: 26% focus bloodlust, blood_fury, lock_and_load, precise_shots, steady_focus, trick_shots, trueshot, wild_spirits, potion_of_spectral_agility
0:08.810 trickshots N multishot Fluffy_Pillow 37.2/100: 37% focus bloodlust, blood_fury, lock_and_load, precise_shots(2), steady_focus, trueshot, wild_spirits, potion_of_spectral_agility
0:09.726 trickshots L aimed_shot Fluffy_Pillow 28.5/100: 28% focus bloodlust, blood_fury, lock_and_load, precise_shots, steady_focus, trick_shots, trueshot, wild_spirits, potion_of_spectral_agility
0:10.642 trickshots N multishot Fluffy_Pillow 39.8/100: 40% focus bloodlust, blood_fury, lock_and_load, precise_shots(2), steady_focus, trueshot, wild_spirits, potion_of_spectral_agility
0:11.559 trickshots L aimed_shot Fluffy_Pillow 31.1/100: 31% focus bloodlust, blood_fury, lock_and_load, precise_shots, steady_focus, trick_shots, trueshot, wild_spirits, potion_of_spectral_agility
0:12.474 trickshots N multishot Fluffy_Pillow 42.4/100: 42% focus bloodlust, blood_fury, precise_shots(2), steady_focus, trueshot, wild_spirits, potion_of_spectral_agility
0:13.391 trickshots M rapid_fire Fluffy_Pillow 33.7/100: 34% focus bloodlust, blood_fury, precise_shots, steady_focus, trick_shots, trueshot, wild_spirits, potion_of_spectral_agility
0:14.869 trickshots N multishot Fluffy_Pillow 62.9/100: 63% focus bloodlust, blood_fury, precise_shots, steady_focus, trueshot, wild_spirits, potion_of_spectral_agility
0:15.785 trickshots L aimed_shot Fluffy_Pillow 54.2/100: 54% focus bloodlust, blood_fury, steady_focus, trick_shots, trueshot, wild_spirits, potion_of_spectral_agility
0:16.701 trickshots N multishot Fluffy_Pillow 30.4/100: 30% focus bloodlust, blood_fury, precise_shots, trueshot, wild_spirits, potion_of_spectral_agility
0:17.679 trickshots Q steady_shot Fluffy_Pillow 21.7/100: 22% focus bloodlust, blood_fury, trick_shots, trueshot, wild_spirits, potion_of_spectral_agility
0:18.820 trickshots F steady_shot Fluffy_Pillow 49.8/100: 50% focus bloodlust, trick_shots, trueshot, wild_spirits, potion_of_spectral_agility
0:19.963 trickshots L aimed_shot Fluffy_Pillow 78.0/100: 78% focus bloodlust, steady_focus, trick_shots, trueshot, wild_spirits, potion_of_spectral_agility
0:20.880 trickshots N multishot Fluffy_Pillow 54.3/100: 54% focus bloodlust, precise_shots(2), steady_focus, trueshot, potion_of_spectral_agility
0:21.794 trickshots L aimed_shot Fluffy_Pillow 45.6/100: 46% focus bloodlust, precise_shots, steady_focus, trick_shots, trueshot, potion_of_spectral_agility
0:22.708 trickshots I flare Fluffy_Pillow 21.9/100: 22% focus bloodlust, precise_shots(2), steady_focus, trueshot, potion_of_spectral_agility
0:23.623 trickshots N multishot Fluffy_Pillow 30.5/100: 30% focus bloodlust, precise_shots(2), steady_focus, potion_of_spectral_agility
0:24.539 trickshots M rapid_fire Fluffy_Pillow 18.0/100: 18% focus bloodlust, precise_shots, steady_focus, trick_shots, potion_of_spectral_agility
0:25.984 trickshots N multishot Fluffy_Pillow 36.9/100: 37% focus bloodlust, precise_shots, steady_focus, potion_of_spectral_agility
0:26.899 trickshots Q steady_shot Fluffy_Pillow 24.4/100: 24% focus bloodlust, steady_focus, trick_shots, potion_of_spectral_agility
0:27.968 trickshots L aimed_shot Fluffy_Pillow 43.2/100: 43% focus bloodlust, steady_focus, trick_shots, potion_of_spectral_agility
0:29.492 trickshots N multishot Fluffy_Pillow 20.8/100: 21% focus bloodlust, precise_shots, steady_focus
0:30.409 trickshots Q steady_shot Fluffy_Pillow 8.3/100: 8% focus bloodlust, steady_focus, trick_shots
0:31.475 trickshots F steady_shot Fluffy_Pillow 27.1/100: 27% focus bloodlust, steady_focus, trick_shots
0:32.543 trickshots L aimed_shot Fluffy_Pillow 45.9/100: 46% focus bloodlust, steady_focus, trick_shots
0:34.066 trickshots N multishot Fluffy_Pillow 23.4/100: 23% focus bloodlust, precise_shots, steady_focus
0:34.982 trickshots Q steady_shot Fluffy_Pillow 10.9/100: 11% focus bloodlust, steady_focus, trick_shots
0:36.048 trickshots Q steady_shot Fluffy_Pillow 29.7/100: 30% focus bloodlust, steady_focus, trick_shots
0:37.117 trickshots Q steady_shot Fluffy_Pillow 48.5/100: 48% focus bloodlust, steady_focus, trick_shots
0:38.185 trickshots L aimed_shot Fluffy_Pillow 67.3/100: 67% focus bloodlust, steady_focus, trick_shots
0:39.709 trickshots N multishot Fluffy_Pillow 44.8/100: 45% focus bloodlust, precise_shots, steady_focus
0:40.626 trickshots Q steady_shot Fluffy_Pillow 32.4/100: 32% focus bloodlust, steady_focus, trick_shots
0:41.693 trickshots H tar_trap Fluffy_Pillow 49.8/100: 50% focus steady_focus, trick_shots
0:42.883 trickshots P multishot Fluffy_Pillow 57.4/100: 57% focus steady_focus, trick_shots
0:44.071 trickshots I flare Fluffy_Pillow 44.9/100: 45% focus steady_focus, trick_shots
0:45.261 trickshots M rapid_fire Fluffy_Pillow 52.4/100: 52% focus steady_focus, trick_shots
0:47.090 trickshots N multishot Fluffy_Pillow 71.0/100: 71% focus steady_focus
0:48.279 trickshots L aimed_shot Fluffy_Pillow 58.5/100: 59% focus steady_focus, trick_shots
0:50.256 trickshots G double_tap Fluffy_Pillow 36.0/100: 36% focus precise_shots(2), steady_focus
0:51.446 trickshots N multishot Fluffy_Pillow 43.6/100: 44% focus double_tap, precise_shots(2), steady_focus
0:52.636 trickshots N multishot Fluffy_Pillow 30.9/100: 31% focus double_tap, lock_and_load, precise_shots, trick_shots
0:53.908 trickshots L aimed_shot Fluffy_Pillow 18.4/100: 18% focus double_tap, lock_and_load, trick_shots
0:55.181 trickshots N multishot Fluffy_Pillow 25.9/100: 26% focus precise_shots
0:56.452 trickshots Q steady_shot Fluffy_Pillow 13.4/100: 13% focus trick_shots
0:57.935 trickshots F steady_shot Fluffy_Pillow 32.2/100: 32% focus trick_shots
0:59.421 trickshots L aimed_shot Fluffy_Pillow 51.0/100: 51% focus steady_focus, trick_shots
1:01.400 trickshots N multishot Fluffy_Pillow 28.5/100: 29% focus precise_shots, steady_focus
1:02.587 trickshots Q steady_shot Fluffy_Pillow 16.0/100: 16% focus steady_focus, trick_shots
1:03.973 trickshots I flare Fluffy_Pillow 34.8/100: 35% focus steady_focus, trick_shots
1:05.258 trickshots L aimed_shot Fluffy_Pillow 42.9/100: 43% focus steady_focus, trick_shots
1:07.411 trickshots N multishot Fluffy_Pillow 21.6/100: 22% focus precise_shots, steady_focus
1:08.600 trickshots M rapid_fire Fluffy_Pillow 9.1/100: 9% focus steady_focus, trick_shots
1:10.365 trickshots N multishot Fluffy_Pillow 27.3/100: 27% focus steady_focus
1:11.555 trickshots Q steady_shot Fluffy_Pillow 14.8/100: 15% focus steady_focus, trick_shots
1:12.943 trickshots F steady_shot Fluffy_Pillow 33.6/100: 34% focus steady_focus, trick_shots
1:14.330 trickshots Q steady_shot Fluffy_Pillow 52.4/100: 52% focus steady_focus, trick_shots
1:15.717 trickshots L aimed_shot Fluffy_Pillow 71.1/100: 71% focus steady_focus, trick_shots
1:17.696 trickshots N multishot Fluffy_Pillow 48.7/100: 49% focus precise_shots(2), steady_focus
1:18.886 trickshots Q steady_shot Fluffy_Pillow 36.2/100: 36% focus precise_shots, steady_focus, trick_shots
1:20.273 trickshots Q steady_shot Fluffy_Pillow 55.0/100: 55% focus precise_shots, steady_focus, trick_shots
1:21.660 trickshots N multishot Fluffy_Pillow 73.8/100: 74% focus precise_shots, steady_focus, trick_shots
1:22.849 trickshots P multishot Fluffy_Pillow 61.3/100: 61% focus steady_focus, trick_shots
1:24.036 trickshots H tar_trap Fluffy_Pillow 48.8/100: 49% focus steady_focus, trick_shots
1:25.226 trickshots L aimed_shot Fluffy_Pillow 56.3/100: 56% focus steady_focus, trick_shots
1:27.205 trickshots I flare Fluffy_Pillow 33.9/100: 34% focus precise_shots, steady_focus
1:28.394 trickshots N multishot Fluffy_Pillow 41.4/100: 41% focus precise_shots, steady_focus
1:29.584 trickshots M rapid_fire Fluffy_Pillow 28.9/100: 29% focus steady_focus, trick_shots
1:31.294 default 9 use_items Fluffy_Pillow 46.7/100: 47% focus steady_focus
1:31.294 trickshots N multishot Fluffy_Pillow 46.7/100: 47% focus steady_focus
1:32.485 trickshots Q steady_shot Fluffy_Pillow 34.3/100: 34% focus steady_focus, trick_shots
1:33.872 trickshots F steady_shot Fluffy_Pillow 53.1/100: 53% focus steady_focus, trick_shots
1:35.259 trickshots L aimed_shot Fluffy_Pillow 71.8/100: 72% focus steady_focus, trick_shots
1:37.238 trickshots N multishot Fluffy_Pillow 49.4/100: 49% focus precise_shots, steady_focus
1:38.428 trickshots Q steady_shot Fluffy_Pillow 36.9/100: 37% focus steady_focus, trick_shots
1:39.815 trickshots L aimed_shot Fluffy_Pillow 55.7/100: 56% focus lock_and_load, steady_focus, trick_shots
1:41.004 trickshots N multishot Fluffy_Pillow 63.2/100: 63% focus precise_shots, steady_focus
1:42.194 trickshots Q steady_shot Fluffy_Pillow 50.7/100: 51% focus steady_focus, trick_shots
1:43.581 trickshots L aimed_shot Fluffy_Pillow 69.5/100: 70% focus steady_focus, trick_shots
1:45.561 trickshots N multishot Fluffy_Pillow 47.0/100: 47% focus precise_shots(2), steady_focus
1:46.751 trickshots Q steady_shot Fluffy_Pillow 34.6/100: 35% focus precise_shots, steady_focus, trick_shots
1:48.138 trickshots F steady_shot Fluffy_Pillow 53.3/100: 53% focus precise_shots, steady_focus, trick_shots
1:49.524 trickshots I flare Fluffy_Pillow 72.1/100: 72% focus precise_shots, steady_focus, trick_shots
1:50.713 trickshots G double_tap Fluffy_Pillow 79.6/100: 80% focus precise_shots, steady_focus, trick_shots
1:51.900 trickshots L aimed_shot Fluffy_Pillow 87.2/100: 87% focus double_tap, lock_and_load, precise_shots, steady_focus, trick_shots
1:53.088 trickshots N multishot Fluffy_Pillow 94.7/100: 95% focus precise_shots(2), steady_focus
1:54.277 trickshots M rapid_fire Fluffy_Pillow 82.2/100: 82% focus precise_shots, steady_focus, trick_shots
1:56.059 trickshots N multishot Fluffy_Pillow 100.0/100: 100% focus precise_shots, steady_focus
1:57.248 trickshots L aimed_shot Fluffy_Pillow 87.5/100: 88% focus steady_focus, trick_shots
1:59.225 trickshots N multishot Fluffy_Pillow 65.0/100: 65% focus precise_shots, steady_focus
2:00.411 trickshots Q steady_shot Fluffy_Pillow 52.5/100: 53% focus steady_focus, trick_shots
2:01.797 trickshots F steady_shot Fluffy_Pillow 71.3/100: 71% focus steady_focus, trick_shots
2:03.181 trickshots J wild_spirits Fluffy_Pillow 90.1/100: 90% focus steady_focus, trick_shots
2:04.369 trickshots K trueshot Fluffy_Pillow 97.6/100: 98% focus steady_focus, trick_shots
2:04.369 cds D blood_fury Fluffy_Pillow 97.6/100: 98% focus steady_focus, trick_shots, trueshot
2:04.369 trickshots L aimed_shot Fluffy_Pillow 97.6/100: 98% focus blood_fury, steady_focus, trick_shots, trueshot
2:05.559 trickshots N multishot Fluffy_Pillow 66.9/100: 67% focus blood_fury, precise_shots, steady_focus, trueshot, wild_spirits
2:06.748 trickshots L aimed_shot Fluffy_Pillow 58.2/100: 58% focus blood_fury, steady_focus, trick_shots, trueshot, wild_spirits
2:07.937 trickshots N multishot Fluffy_Pillow 34.5/100: 35% focus blood_fury, precise_shots(2), steady_focus, trueshot, wild_spirits
2:09.127 trickshots H tar_trap Fluffy_Pillow 25.8/100: 26% focus blood_fury, precise_shots, steady_focus, trick_shots, trueshot, wild_spirits
2:10.313 trickshots L aimed_shot Fluffy_Pillow 37.1/100: 37% focus blood_fury, precise_shots, steady_focus, trick_shots, trueshot, wild_spirits
2:11.500 trickshots I flare Fluffy_Pillow 13.3/100: 13% focus blood_fury, precise_shots(2), steady_focus, trueshot, wild_spirits
2:12.687 trickshots N multishot Fluffy_Pillow 24.6/100: 25% focus blood_fury, precise_shots(2), steady_focus, trueshot, wild_spirits
2:13.876 trickshots M rapid_fire Fluffy_Pillow 15.9/100: 16% focus blood_fury, precise_shots, steady_focus, trick_shots, trueshot, wild_spirits
2:15.594 trickshots N multishot Fluffy_Pillow 45.2/100: 45% focus blood_fury, precise_shots, steady_focus, trueshot, wild_spirits
2:16.783 trickshots L aimed_shot Fluffy_Pillow 36.5/100: 36% focus blood_fury, steady_focus, trick_shots, trueshot, wild_spirits
2:17.973 trickshots Q steady_shot Fluffy_Pillow 12.8/100: 13% focus blood_fury, precise_shots, steady_focus, trueshot, wild_spirits
2:19.361 trickshots F steady_shot Fluffy_Pillow 40.2/100: 40% focus blood_fury, precise_shots, trueshot, wild_spirits
2:20.844 trickshots N multishot Fluffy_Pillow 68.4/100: 68% focus precise_shots, steady_focus, trueshot, wild_spirits
2:22.033 trickshots L aimed_shot Fluffy_Pillow 59.7/100: 60% focus steady_focus, trick_shots, trueshot, wild_spirits
2:23.221 trickshots N multishot Fluffy_Pillow 36.0/100: 36% focus precise_shots(2), steady_focus, trueshot
2:24.407 trickshots M rapid_fire Fluffy_Pillow 26.0/100: 26% focus precise_shots, steady_focus, trick_shots
2:26.216 trickshots N multishot Fluffy_Pillow 44.4/100: 44% focus precise_shots, steady_focus
2:27.405 trickshots Q steady_shot Fluffy_Pillow 32.0/100: 32% focus steady_focus, trick_shots
2:28.791 trickshots L aimed_shot Fluffy_Pillow 50.7/100: 51% focus steady_focus, trick_shots
2:30.769 trickshots N multishot Fluffy_Pillow 28.3/100: 28% focus precise_shots(2), steady_focus
2:31.957 trickshots I flare Fluffy_Pillow 15.8/100: 16% focus precise_shots, steady_focus, trick_shots
2:33.144 trickshots Q steady_shot Fluffy_Pillow 23.3/100: 23% focus precise_shots, steady_focus, trick_shots
2:34.530 trickshots F steady_shot Fluffy_Pillow 42.1/100: 42% focus precise_shots, steady_focus, trick_shots
2:35.917 trickshots N multishot Fluffy_Pillow 60.8/100: 61% focus precise_shots, steady_focus, trick_shots
2:37.104 trickshots L aimed_shot Fluffy_Pillow 48.3/100: 48% focus steady_focus, trick_shots
2:39.084 trickshots N multishot Fluffy_Pillow 25.9/100: 26% focus lock_and_load, precise_shots(2), steady_focus
2:40.274 trickshots Q steady_shot Fluffy_Pillow 13.4/100: 13% focus lock_and_load, precise_shots, steady_focus, trick_shots
2:41.660 trickshots N multishot Fluffy_Pillow 32.2/100: 32% focus lock_and_load, precise_shots, steady_focus, trick_shots
2:42.849 trickshots L aimed_shot Fluffy_Pillow 19.7/100: 20% focus lock_and_load, steady_focus, trick_shots
2:44.037 trickshots N multishot Fluffy_Pillow 27.2/100: 27% focus precise_shots(2), steady_focus
2:45.226 trickshots M rapid_fire Fluffy_Pillow 14.7/100: 15% focus precise_shots, steady_focus, trick_shots
2:47.127 trickshots N multishot Fluffy_Pillow 33.8/100: 34% focus precise_shots, steady_focus
2:48.315 trickshots Q steady_shot Fluffy_Pillow 21.3/100: 21% focus steady_focus, trick_shots
2:49.701 trickshots F steady_shot Fluffy_Pillow 40.0/100: 40% focus steady_focus, trick_shots
2:51.088 trickshots G double_tap Fluffy_Pillow 58.8/100: 59% focus lock_and_load, steady_focus, trick_shots
2:52.276 trickshots H tar_trap Fluffy_Pillow 66.3/100: 66% focus double_tap, lock_and_load, steady_focus, trick_shots
2:53.464 trickshots L aimed_shot Fluffy_Pillow 73.8/100: 74% focus double_tap, lock_and_load, steady_focus, trick_shots
2:54.653 trickshots I flare Fluffy_Pillow 81.3/100: 81% focus precise_shots, steady_focus
2:55.841 trickshots N multishot Fluffy_Pillow 88.8/100: 89% focus precise_shots, steady_focus
2:57.028 trickshots L aimed_shot Fluffy_Pillow 76.4/100: 76% focus steady_focus, trick_shots
2:59.008 trickshots N multishot Fluffy_Pillow 53.9/100: 54% focus precise_shots, steady_focus
3:00.195 trickshots L aimed_shot Fluffy_Pillow 41.4/100: 41% focus lock_and_load, steady_focus, trick_shots
3:01.384 default 9 use_items Fluffy_Pillow 48.9/100: 49% focus precise_shots, steady_focus
3:01.384 trickshots N multishot Fluffy_Pillow 48.9/100: 49% focus precise_shots, steady_focus
3:02.574 trickshots Q steady_shot Fluffy_Pillow 36.5/100: 36% focus steady_focus, trick_shots
3:03.961 trickshots F steady_shot Fluffy_Pillow 55.2/100: 55% focus steady_focus, trick_shots
3:05.348 trickshots L aimed_shot Fluffy_Pillow 74.0/100: 74% focus steady_focus, trick_shots
3:07.328 trickshots N multishot Fluffy_Pillow 51.5/100: 52% focus precise_shots, steady_focus
3:08.517 trickshots M rapid_fire Fluffy_Pillow 39.1/100: 39% focus steady_focus, trick_shots
3:10.214 trickshots N multishot Fluffy_Pillow 56.8/100: 57% focus steady_focus
3:11.404 trickshots Q steady_shot Fluffy_Pillow 44.3/100: 44% focus steady_focus, trick_shots
3:12.791 trickshots L aimed_shot Fluffy_Pillow 63.1/100: 63% focus steady_focus, trick_shots
3:14.769 trickshots I flare Fluffy_Pillow 40.6/100: 41% focus precise_shots, steady_focus
3:15.958 trickshots N multishot Fluffy_Pillow 48.2/100: 48% focus precise_shots, steady_focus
3:17.149 trickshots Q steady_shot Fluffy_Pillow 35.7/100: 36% focus steady_focus, trick_shots
3:18.536 trickshots F steady_shot Fluffy_Pillow 54.5/100: 54% focus steady_focus, trick_shots
3:19.926 trickshots P multishot Fluffy_Pillow 73.3/100: 73% focus steady_focus, trick_shots
3:21.115 trickshots P multishot Fluffy_Pillow 60.8/100: 61% focus steady_focus, trick_shots
3:22.303 trickshots L aimed_shot Fluffy_Pillow 48.3/100: 48% focus steady_focus, trick_shots
3:24.282 trickshots N multishot Fluffy_Pillow 25.8/100: 26% focus precise_shots, steady_focus
3:25.468 trickshots Q steady_shot Fluffy_Pillow 13.4/100: 13% focus steady_focus, trick_shots
3:26.854 trickshots Q steady_shot Fluffy_Pillow 32.1/100: 32% focus steady_focus, trick_shots
3:28.243 trickshots Q steady_shot Fluffy_Pillow 50.9/100: 51% focus steady_focus, trick_shots
3:29.628 trickshots M rapid_fire Fluffy_Pillow 69.7/100: 70% focus steady_focus, trick_shots
3:31.353 trickshots N multishot Fluffy_Pillow 87.6/100: 88% focus steady_focus
3:32.542 trickshots L aimed_shot Fluffy_Pillow 75.1/100: 75% focus steady_focus, trick_shots
3:34.521 trickshots H tar_trap Fluffy_Pillow 52.7/100: 53% focus precise_shots, steady_focus
3:35.710 trickshots N multishot Fluffy_Pillow 60.2/100: 60% focus precise_shots, steady_focus
3:36.899 trickshots I flare Fluffy_Pillow 47.7/100: 48% focus lock_and_load, steady_focus, trick_shots
3:38.088 trickshots L aimed_shot Fluffy_Pillow 55.2/100: 55% focus lock_and_load, steady_focus, trick_shots
3:39.277 trickshots N multishot Fluffy_Pillow 62.8/100: 63% focus precise_shots(2), steady_focus
3:40.464 trickshots Q steady_shot Fluffy_Pillow 50.3/100: 50% focus precise_shots, steady_focus, trick_shots
3:41.850 trickshots F steady_shot Fluffy_Pillow 69.0/100: 69% focus precise_shots, steady_focus, trick_shots
3:43.236 trickshots N multishot Fluffy_Pillow 87.8/100: 88% focus precise_shots, steady_focus, trick_shots
3:44.425 trickshots L aimed_shot Fluffy_Pillow 75.3/100: 75% focus steady_focus, trick_shots
3:46.405 trickshots N multishot Fluffy_Pillow 52.9/100: 53% focus precise_shots, steady_focus
3:47.594 trickshots Q steady_shot Fluffy_Pillow 40.4/100: 40% focus steady_focus, trick_shots
3:48.981 trickshots P multishot Fluffy_Pillow 59.2/100: 59% focus steady_focus, trick_shots
3:50.171 trickshots L aimed_shot Fluffy_Pillow 46.7/100: 47% focus steady_focus, trick_shots
3:52.317 trickshots G double_tap Fluffy_Pillow 25.3/100: 25% focus precise_shots, steady_focus
3:53.505 trickshots N multishot Fluffy_Pillow 32.8/100: 33% focus double_tap, precise_shots, steady_focus
3:54.692 trickshots M rapid_fire Fluffy_Pillow 20.3/100: 20% focus double_tap, steady_focus, trick_shots
3:56.590 trickshots N multishot Fluffy_Pillow 46.3/100: 46% focus steady_focus
3:57.778 trickshots I flare Fluffy_Pillow 33.9/100: 34% focus steady_focus, trick_shots
3:58.966 trickshots Q steady_shot Fluffy_Pillow 41.1/100: 41% focus trick_shots
4:00.450 trickshots F steady_shot Fluffy_Pillow 59.8/100: 60% focus trick_shots
4:01.933 trickshots L aimed_shot Fluffy_Pillow 78.6/100: 79% focus steady_focus, trick_shots
4:03.912 trickshots J wild_spirits Fluffy_Pillow 56.1/100: 56% focus precise_shots(2), steady_focus
4:05.099 trickshots K trueshot Fluffy_Pillow 63.7/100: 64% focus precise_shots(2), steady_focus
4:05.099 cds D blood_fury Fluffy_Pillow 63.7/100: 64% focus precise_shots(2), steady_focus, trueshot
4:05.099 trickshots N multishot Fluffy_Pillow 63.7/100: 64% focus blood_fury, precise_shots(2), steady_focus, trueshot
4:06.288 trickshots L aimed_shot Fluffy_Pillow 54.9/100: 55% focus blood_fury, precise_shots, steady_focus, trick_shots, trueshot, wild_spirits
4:07.652 trickshots N multishot Fluffy_Pillow 32.9/100: 33% focus blood_fury, precise_shots(2), steady_focus, trueshot, wild_spirits
4:08.839 trickshots M rapid_fire Fluffy_Pillow 24.2/100: 24% focus blood_fury, precise_shots, steady_focus, trick_shots, trueshot, wild_spirits
4:10.634 trickshots N multishot Fluffy_Pillow 50.2/100: 50% focus blood_fury, precise_shots, steady_focus, trueshot, wild_spirits
4:11.824 trickshots L aimed_shot Fluffy_Pillow 41.5/100: 42% focus blood_fury, steady_focus, trick_shots, trueshot, wild_spirits
4:13.013 trickshots Q steady_shot Fluffy_Pillow 17.8/100: 18% focus blood_fury, precise_shots, steady_focus, trueshot, wild_spirits
4:14.399 trickshots F steady_shot Fluffy_Pillow 45.9/100: 46% focus blood_fury, precise_shots, steady_focus, trueshot, wild_spirits
4:15.784 trickshots N multishot Fluffy_Pillow 74.1/100: 74% focus blood_fury, precise_shots, steady_focus, trueshot, wild_spirits
4:16.973 trickshots H tar_trap Fluffy_Pillow 65.4/100: 65% focus blood_fury, steady_focus, trick_shots, trueshot, wild_spirits
4:18.163 trickshots L aimed_shot Fluffy_Pillow 76.7/100: 77% focus blood_fury, steady_focus, trick_shots, trueshot, wild_spirits
4:19.351 trickshots I flare Fluffy_Pillow 53.0/100: 53% focus blood_fury, precise_shots(2), steady_focus, trueshot, wild_spirits
4:20.539 trickshots N multishot Fluffy_Pillow 64.2/100: 64% focus precise_shots(2), steady_focus, trueshot, wild_spirits
4:21.726 trickshots L aimed_shot Fluffy_Pillow 55.5/100: 56% focus precise_shots, steady_focus, trick_shots, trueshot, wild_spirits
4:22.914 trickshots N multishot Fluffy_Pillow 31.8/100: 32% focus precise_shots(2), steady_focus, trueshot, wild_spirits
4:24.102 trickshots M rapid_fire Fluffy_Pillow 23.1/100: 23% focus precise_shots, steady_focus, trick_shots, trueshot
4:25.906 trickshots N multishot Fluffy_Pillow 46.5/100: 47% focus precise_shots, steady_focus
4:27.093 trickshots Q steady_shot Fluffy_Pillow 34.0/100: 34% focus steady_focus, trick_shots
4:28.478 trickshots F steady_shot Fluffy_Pillow 52.8/100: 53% focus steady_focus, trick_shots
4:29.864 trickshots L aimed_shot Fluffy_Pillow 71.6/100: 72% focus steady_focus, trick_shots
4:31.843 default 9 use_items Fluffy_Pillow 49.1/100: 49% focus precise_shots, steady_focus
4:31.843 trickshots N multishot Fluffy_Pillow 49.1/100: 49% focus precise_shots, steady_focus
4:33.034 trickshots L aimed_shot Fluffy_Pillow 36.6/100: 37% focus steady_focus, trick_shots
4:35.011 trickshots Q steady_shot Fluffy_Pillow 14.2/100: 14% focus precise_shots(2), steady_focus
4:36.398 trickshots N multishot Fluffy_Pillow 32.9/100: 33% focus precise_shots(2), steady_focus
4:37.588 trickshots Q steady_shot Fluffy_Pillow 20.5/100: 20% focus precise_shots, steady_focus, trick_shots
4:38.973 trickshots Q steady_shot Fluffy_Pillow 39.2/100: 39% focus precise_shots, steady_focus, trick_shots
4:40.360 trickshots I flare Fluffy_Pillow 58.0/100: 58% focus precise_shots, steady_focus, trick_shots
4:41.549 trickshots N multishot Fluffy_Pillow 65.5/100: 66% focus precise_shots, steady_focus, trick_shots
4:42.739 trickshots L aimed_shot Fluffy_Pillow 53.1/100: 53% focus steady_focus, trick_shots
4:44.717 trickshots N multishot Fluffy_Pillow 30.6/100: 31% focus precise_shots, steady_focus
4:45.904 trickshots M rapid_fire Fluffy_Pillow 18.1/100: 18% focus steady_focus, trick_shots
4:47.698 trickshots N multishot Fluffy_Pillow 36.5/100: 36% focus steady_focus
4:48.887 trickshots O kill_shot Fluffy_Pillow 24.0/100: 24% focus steady_focus, trick_shots
4:50.076 trickshots Q steady_shot Fluffy_Pillow 21.5/100: 22% focus steady_focus, trick_shots
4:51.463 trickshots F steady_shot Fluffy_Pillow 40.3/100: 40% focus steady_focus, trick_shots
4:52.849 trickshots G double_tap Fluffy_Pillow 59.1/100: 59% focus steady_focus, trick_shots
4:54.039 trickshots L aimed_shot Fluffy_Pillow 66.6/100: 67% focus double_tap, steady_focus, trick_shots
4:56.017 trickshots N multishot Fluffy_Pillow 44.1/100: 44% focus precise_shots, steady_focus
4:57.206 trickshots Q steady_shot Fluffy_Pillow 31.6/100: 32% focus steady_focus, trick_shots
4:58.593 trickshots Q steady_shot Fluffy_Pillow 50.4/100: 50% focus steady_focus, trick_shots
4:59.980 trickshots H tar_trap Fluffy_Pillow 69.2/100: 69% focus steady_focus, trick_shots
5:01.168 trickshots L aimed_shot Fluffy_Pillow 76.7/100: 77% focus steady_focus, trick_shots
5:03.147 trickshots I flare Fluffy_Pillow 54.2/100: 54% focus precise_shots(2), steady_focus
5:04.337 trickshots N multishot Fluffy_Pillow 61.8/100: 62% focus precise_shots(2), steady_focus
5:05.526 trickshots O kill_shot Fluffy_Pillow 49.3/100: 49% focus precise_shots, steady_focus, trick_shots
5:06.714 trickshots M rapid_fire Fluffy_Pillow 46.8/100: 47% focus precise_shots, steady_focus, trick_shots
5:08.468 trickshots N multishot Fluffy_Pillow 64.9/100: 65% focus precise_shots, steady_focus
5:09.656 trickshots L aimed_shot Fluffy_Pillow 52.4/100: 52% focus steady_focus, trick_shots
5:11.733 trickshots N multishot Fluffy_Pillow 30.6/100: 31% focus precise_shots(2), steady_focus
5:12.921 trickshots Q steady_shot Fluffy_Pillow 18.1/100: 18% focus precise_shots, steady_focus, trick_shots
5:14.308 trickshots F steady_shot Fluffy_Pillow 36.9/100: 37% focus precise_shots, steady_focus, trick_shots
5:15.694 trickshots N multishot Fluffy_Pillow 55.4/100: 55% focus precise_shots, steady_focus, trick_shots
5:16.882 trickshots O kill_shot Fluffy_Pillow 42.9/100: 43% focus steady_focus, trick_shots
5:18.069 trickshots Q steady_shot Fluffy_Pillow 40.4/100: 40% focus steady_focus, trick_shots
5:19.457 trickshots L aimed_shot Fluffy_Pillow 59.2/100: 59% focus steady_focus, trick_shots
5:21.435 trickshots N multishot Fluffy_Pillow 36.7/100: 37% focus precise_shots(2), steady_focus
5:22.622 trickshots Q steady_shot Fluffy_Pillow 24.2/100: 24% focus precise_shots, steady_focus, trick_shots
5:24.009 trickshots I flare Fluffy_Pillow 43.0/100: 43% focus precise_shots, steady_focus, trick_shots
5:25.197 trickshots Q steady_shot Fluffy_Pillow 50.5/100: 51% focus precise_shots, steady_focus, trick_shots
5:26.584 cds E potion Fluffy_Pillow 69.3/100: 69% focus precise_shots, steady_focus, trick_shots
5:26.584 trickshots F steady_shot Fluffy_Pillow 69.3/100: 69% focus precise_shots, steady_focus, trick_shots, potion_of_spectral_agility
5:27.971 trickshots M rapid_fire Fluffy_Pillow 88.1/100: 88% focus precise_shots, steady_focus, trick_shots, potion_of_spectral_agility
5:29.734 trickshots N multishot Fluffy_Pillow 100.0/100: 100% focus precise_shots, steady_focus, potion_of_spectral_agility
5:30.921 trickshots L aimed_shot Fluffy_Pillow 87.5/100: 88% focus steady_focus, trick_shots, potion_of_spectral_agility
5:32.900 trickshots N multishot Fluffy_Pillow 65.0/100: 65% focus precise_shots, steady_focus, potion_of_spectral_agility
5:34.088 trickshots O kill_shot Fluffy_Pillow 52.6/100: 53% focus steady_focus, trick_shots, potion_of_spectral_agility
5:35.275 trickshots Q steady_shot Fluffy_Pillow 50.1/100: 50% focus steady_focus, trick_shots, potion_of_spectral_agility
5:36.661 trickshots P multishot Fluffy_Pillow 68.8/100: 69% focus steady_focus, trick_shots, potion_of_spectral_agility
5:37.849 trickshots P multishot Fluffy_Pillow 56.4/100: 56% focus steady_focus, trick_shots, potion_of_spectral_agility
5:39.038 trickshots L aimed_shot Fluffy_Pillow 43.9/100: 44% focus steady_focus, trick_shots, potion_of_spectral_agility
5:41.015 trickshots N multishot Fluffy_Pillow 21.4/100: 21% focus precise_shots(2), steady_focus, potion_of_spectral_agility
5:42.204 trickshots Q steady_shot Fluffy_Pillow 8.9/100: 9% focus precise_shots, steady_focus, trick_shots, potion_of_spectral_agility
5:43.592 trickshots F steady_shot Fluffy_Pillow 27.4/100: 27% focus precise_shots, trick_shots, potion_of_spectral_agility
5:45.074 trickshots H tar_trap Fluffy_Pillow 46.2/100: 46% focus precise_shots, steady_focus, trick_shots, potion_of_spectral_agility
5:46.260 trickshots O kill_shot Fluffy_Pillow 53.7/100: 54% focus precise_shots, steady_focus, trick_shots, potion_of_spectral_agility
5:47.451 trickshots I flare Fluffy_Pillow 51.3/100: 51% focus precise_shots, steady_focus, trick_shots, potion_of_spectral_agility
5:48.637 trickshots M rapid_fire Fluffy_Pillow 58.8/100: 59% focus precise_shots, steady_focus, trick_shots, potion_of_spectral_agility
5:50.549 trickshots N multishot Fluffy_Pillow 77.9/100: 78% focus precise_shots, steady_focus, potion_of_spectral_agility
5:51.737 trickshots L aimed_shot Fluffy_Pillow 65.4/100: 65% focus steady_focus, trick_shots

Stats

Level Bonus (60) Race Bonus (orc) Raid-Buffed Unbuffed Gear Amount
Strength 274 3 295 277 0
Agility 450 -3 1411 1297 789 (677)
Stamina 414 1 1800 1715 1300
Intellect 369 -1 405 368 0
Spirit 0 0 0 0 0
Health 36000 34300 0
Focus 100 100 0
Spell Power 405 368 0
Crit 22.66% 22.66% 443
Haste 18.30% 18.30% 604
Versatility 3.65% 3.65% 146
Attack Power 1482 1297 0
Mastery 14.00% 14.00% 504
Armor 818 818 818
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 217.00
Local Head Helm of Insatiable Appetite
ilevel: 213, stats: { 103 Armor, +126 Sta, +92 Haste, +40 Mastery, +72 AgiInt }
Local Neck Noble's Birthstone Pendant
ilevel: 213, stats: { +71 Sta, +47 Crit, +147 Mastery }
Local Shoulders Boneshatter Pauldrons
ilevel: 235, stats: { 107 Armor, +124 Sta, +44 unknown(24), +44 unknown(25), +66 AgiInt }
item effects: { equip: Soulforge Embers }
Local Chest Master Huntsman's Bandolier
ilevel: 213, stats: { 137 Armor, +126 Sta, +45 Crit, +86 Mastery, +72 AgiInt }, enchant: { +20 StrAgi }
Local Waist Load-Bearing Belt
ilevel: 213, stats: { 77 Armor, +95 Sta, +69 Haste, +30 Vers, +54 AgiInt }
Local Legs Greaves of Enigmatic Energies
ilevel: 213, stats: { 120 Armor, +126 Sta, +91 Crit, +41 Mastery, +72 AgiInt }
Local Feet Stoneclas Stompers
ilevel: 213, stats: { 86 Armor, +95 Sta, +69 Crit, +30 Mastery, +54 AgiInt }, enchant: { +15 Agi }
Local Wrists Bangles of Errant Pride
ilevel: 213, stats: { 69 Armor, +71 Sta, +48 Crit, +24 Mastery, +40 AgiInt }
Local Hands Oathsworn Soldier's Gauntlets
ilevel: 220, stats: { 80 Armor, +104 Sta, +67 Crit, +36 Haste, +58 AgiInt }
Local Finger1 Most Regal Signet of Sire Denathrius
ilevel: 220, stats: { +77 Sta, +161 Haste, +44 Mastery }, enchant: { +16 Crit }
item effects: { equip: Denathrius' Privilege }
Local Finger2 Ritualist's Treasured Ring
ilevel: 213, stats: { +71 Sta, +44 Crit, +149 Haste }, enchant: { +16 Crit }
Local Trinket1 Dreadfire Vessel
ilevel: 220, stats: { +73 StrAgiInt }, enchant: shadowcore_oil
item effects: { use: Dreadfire Vessel }
Local Trinket2 Stone Legion Heraldry
ilevel: 220, stats: { +73 StrAgi }
item effects: { equip: Stone Legionnaire }
Local Back Crest of the Legionnaire General
ilevel: 220, stats: { 39 Armor, +77 Sta, +52 Haste, +24 Vers, +43 StrAgiInt }
Local Main Hand Deadeye Blunderbuss
ilevel: 220, weapon: { 121 - 227, 3 }, stats: { +77 Agi, +137 Sta, +45 Haste, +92 Mastery }, enchant: sinful_revelation

Profile

hunter="soulforge_embers"
source=default
spec=marksmanship
level=60
race=orc
role=attack
position=ranged_back
talents=1101032
covenant=night_fae
soulbind=140:6//188:6

# Default consumables
potion=spectral_agility
flask=spectral_flask_of_power
food=feast_of_gluttonous_hedonism
augmentation=veiled

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask
actions.precombat+=/augmentation
actions.precombat+=/food
# Snapshot raid buffed stats before combat begins and pre-potting is done.
actions.precombat+=/snapshot_stats
actions.precombat+=/tar_trap,if=runeforge.soulforge_embers
actions.precombat+=/double_tap,precast_time=10,if=!covenant.kyrian&(!talent.volley|active_enemies<2)
actions.precombat+=/aimed_shot,if=active_enemies<3
actions.precombat+=/steady_shot,if=active_enemies>2

# Executed every time the actor is available.
actions=auto_shot
actions+=/counter_shot,line_cd=30,if=runeforge.sephuzs_proclamation|soulbind.niyas_tools_poison|(conduit.reversal_of_fortune&!runeforge.sephuzs_proclamation)
actions+=/use_items
actions+=/call_action_list,name=cds
actions+=/call_action_list,name=st,if=active_enemies<3
actions+=/call_action_list,name=trickshots,if=active_enemies>2

actions.cds=berserking,if=buff.trueshot.up|target.time_to_die<13
actions.cds+=/blood_fury,if=buff.trueshot.up|target.time_to_die<16
actions.cds+=/ancestral_call,if=buff.trueshot.up|target.time_to_die<16
actions.cds+=/fireblood,if=buff.trueshot.up|target.time_to_die<9
actions.cds+=/lights_judgment,if=buff.trueshot.down
actions.cds+=/bag_of_tricks,if=buff.trueshot.down
actions.cds+=/potion,if=buff.trueshot.up&buff.bloodlust.up|buff.trueshot.up&target.health.pct<20|target.time_to_die<26

actions.st=steady_shot,if=talent.steady_focus&(prev_gcd.1.steady_shot&buff.steady_focus.remains<5|buff.steady_focus.down)
actions.st+=/kill_shot
actions.st+=/double_tap,if=covenant.kyrian&cooldown.resonating_arrow.remains<gcd|!covenant.kyrian&(cooldown.aimed_shot.up|cooldown.rapid_fire.remains>cooldown.aimed_shot.remains)
actions.st+=/flare,if=tar_trap.up&runeforge.soulforge_embers
actions.st+=/tar_trap,if=runeforge.soulforge_embers&tar_trap.remains<gcd&cooldown.flare.remains<gcd
actions.st+=/explosive_shot
actions.st+=/wild_spirits
actions.st+=/flayed_shot
actions.st+=/death_chakram,if=focus+cast_regen<focus.max
actions.st+=/volley,if=buff.precise_shots.down|!talent.chimaera_shot|active_enemies<2
actions.st+=/a_murder_of_crows
actions.st+=/resonating_arrow
actions.st+=/trueshot,if=buff.precise_shots.down|buff.resonating_arrow.up|buff.wild_spirits.up|buff.volley.up&active_enemies>1
actions.st+=/aimed_shot,target_if=min:(dot.serpent_sting.remains<?action.serpent_sting.in_flight_to_target*dot.serpent_sting.duration),if=buff.precise_shots.down|(buff.trueshot.up|full_recharge_time<gcd+cast_time)&(!talent.chimaera_shot|active_enemies<2)|buff.trick_shots.remains>execute_time&active_enemies>1
actions.st+=/rapid_fire,if=focus+cast_regen<focus.max&(buff.trueshot.down|!runeforge.eagletalons_true_focus)&(buff.double_tap.down|talent.streamline)
actions.st+=/chimaera_shot,if=buff.precise_shots.up|focus>cost+action.aimed_shot.cost
actions.st+=/arcane_shot,if=buff.precise_shots.up|focus>cost+action.aimed_shot.cost
actions.st+=/serpent_sting,target_if=min:remains,if=refreshable&target.time_to_die>duration
actions.st+=/barrage,if=active_enemies>1
actions.st+=/rapid_fire,if=focus+cast_regen<focus.max&(buff.double_tap.down|talent.streamline)
actions.st+=/steady_shot

actions.trickshots=steady_shot,if=talent.steady_focus&in_flight&buff.steady_focus.remains<5
actions.trickshots+=/double_tap,if=covenant.kyrian&cooldown.resonating_arrow.remains<gcd|cooldown.rapid_fire.remains<cooldown.aimed_shot.full_recharge_time|!(talent.streamline&runeforge.surging_shots)|!covenant.kyrian
actions.trickshots+=/tar_trap,if=runeforge.soulforge_embers&tar_trap.remains<gcd&cooldown.flare.remains<gcd
actions.trickshots+=/flare,if=tar_trap.up&runeforge.soulforge_embers
actions.trickshots+=/explosive_shot
actions.trickshots+=/wild_spirits
actions.trickshots+=/resonating_arrow
actions.trickshots+=/volley
actions.trickshots+=/barrage
actions.trickshots+=/trueshot
actions.trickshots+=/rapid_fire,if=buff.trick_shots.remains>=execute_time&runeforge.surging_shots&buff.double_tap.down
actions.trickshots+=/aimed_shot,target_if=min:(dot.serpent_sting.remains<?action.serpent_sting.in_flight_to_target*dot.serpent_sting.duration),if=buff.trick_shots.remains>=execute_time&(buff.precise_shots.down|full_recharge_time<cast_time+gcd|buff.trueshot.up)
actions.trickshots+=/death_chakram,if=focus+cast_regen<focus.max
actions.trickshots+=/rapid_fire,if=buff.trick_shots.remains>=execute_time
actions.trickshots+=/multishot,if=buff.trick_shots.down|buff.precise_shots.up&focus>cost+action.aimed_shot.cost&(!talent.chimaera_shot|active_enemies>3)
actions.trickshots+=/chimaera_shot,if=buff.precise_shots.up&focus>cost+action.aimed_shot.cost&active_enemies<4
actions.trickshots+=/kill_shot,if=buff.dead_eye.down
actions.trickshots+=/a_murder_of_crows
actions.trickshots+=/flayed_shot
actions.trickshots+=/serpent_sting,target_if=min:dot.serpent_sting.remains,if=refreshable
actions.trickshots+=/multishot,if=focus>cost+action.aimed_shot.cost
actions.trickshots+=/steady_shot

head=helm_of_insatiable_appetite,id=183001,bonus_id=7188/1485,ilevel=213
neck=nobles_birthstone_pendant,id=183039,bonus_id=7188/1485,ilevel=213
shoulders=boneshatter_pauldrons,id=172327,bonus_id=7005,ilevel=235
back=crest_of_the_legionnaire_general,id=183032,bonus_id=6805,ilevel=220
chest=master_huntsmans_bandolier,id=182988,bonus_id=6805,ilevel=213,enchant=eternal_skirmish
wrists=bangles_of_errant_pride,id=182977,bonus_id=6805,ilevel=213
hands=oathsworn_soldiers_gauntlets,id=182991,bonus_id=6805,ilevel=220
waist=loadbearing_belt,id=183016,bonus_id=6805,ilevel=213
legs=greaves_of_enigmatic_energies,id=183012,bonus_id=6805,ilevel=213
feet=stoneclas_stompers,id=183006,bonus_id=6805,ilevel=213,enchant=15agility
finger1=most_regal_signet_of_sire_denathrius,id=183036,bonus_id=6805,ilevel=220,enchant=16crit
finger2=ritualists_treasured_ring,id=183037,bonus_id=6805,ilevel=213,enchant=16crit
trinket1=dreadfire_vessel,id=184030,bonus_id=6805,ilevel=220,enchant=shadowcore_oil
trinket2=stone_legion_heraldry,id=184027,bonus_id=6805,ilevel=220
main_hand=deadeye_blunderbuss,id=184250,bonus_id=6805,ilevel=220,enchant=sinful_revelation

# Gear Summary
# gear_ilvl=217.27
# gear_agility=789
# gear_stamina=1300
# gear_crit_rating=443
# gear_haste_rating=604
# gear_mastery_rating=504
# gear_versatility_rating=54
# gear_armor=818

surging_shots : 11137 dps, 3803 dps to main target

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
11136.7 11136.7 19.7 / 0.177% 1335.6 / 12.0% 1116.0
RPS Out RPS In Primary Resource Waiting APM Active Skill
10.0 9.8 Focus 0.00% 47.0 100.0% 100%
Talents
Night Fae
Runeforge

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
surging_shots 11137
Aimed Shot 3427 (3800) 30.8% (34.1%) 44.6 6.69sec 25516 16249 Direct 222.7 (246.0) 3754 7533 4610 22.7% (22.7%)

Stats Details: Aimed Shot

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 44.59 222.65 0.00 0.00 1.5703 0.0000 1026599.67 1466394.97 29.99% 16248.58 16248.58
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 77.33% 172.18 120 224 3754.15 2524 9967 3756.54 3521 4002 646433 923365 29.99%
crit 22.67% 50.47 23 78 7532.87 5048 19934 7536.63 6343 9135 380167 543030 29.99%

Action Details: Aimed Shot

  • id:19434
  • school:physical
  • range:40.0
  • travel_speed:100.0000
  • radius:8.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:12.000
  • cooldown hasted:true
  • base_recharge_multiplier:1.000
  • base_execute_time:2.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:focus
  • base_cost:35.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:19434
  • name:Aimed Shot
  • school:physical
  • tooltip:
  • description:A powerful aimed shot that deals {$s1=0} Physical damage.

Action Priority List

    trickshots
    [K]:44.75
  • if_expr:buff.trick_shots.remains>=execute_time&(buff.precise_shots.down|full_recharge_time<cast_time+gcd|buff.trueshot.up)
  • target_if_expr:(dot.serpent_sting.remains<?action.serpent_sting.in_flight_to_target*dot.serpent_sting.duration)
    Aimed Shot (_double_tap) 373 3.3% 0.0 0.00sec 0 0 Direct 23.4 3879 7722 4753 22.7%

Stats Details: Aimed Shot Double Tap

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 0.00 23.36 0.00 0.00 0.0000 0.0000 111061.12 158639.71 29.99% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 77.27% 18.05 5 31 3878.99 2524 9967 3903.76 3112 5321 69991 99974 29.99%
crit 22.73% 5.31 0 13 7721.70 5048 19934 7697.60 0 18806 41071 58665 29.72%

Action Details: Aimed Shot Double Tap

  • id:19434
  • school:physical
  • range:40.0
  • travel_speed:100.0000
  • radius:8.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:12.000
  • cooldown hasted:true
  • base_recharge_multiplier:1.000
  • base_execute_time:2.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:focus
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:19434
  • name:Aimed Shot
  • school:physical
  • tooltip:
  • description:A powerful aimed shot that deals {$s1=0} Physical damage.
Auto Shot 345 3.1% 104.8 2.88sec 989 434 Direct 104.6 808 1615 991 22.7%

Stats Details: Auto Shot

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 104.78 104.55 0.00 0.00 2.2770 0.0000 103598.67 147980.34 29.99% 434.22 434.22
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 77.29% 80.81 56 109 807.51 774 1019 807.39 793 821 65257 93213 29.99%
crit 22.71% 23.74 11 41 1614.65 1548 2037 1614.66 1553 1685 38342 54767 29.99%

Action Details: Auto Shot

  • id:75
  • school:physical
  • range:40.0
  • travel_speed:60.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00

Spelldata

  • id:75
  • name:Auto Shot
  • school:physical
  • tooltip:Firing at the target.
  • description:Automatically shoots the target until cancelled.
Dreadfire Vessel 137 1.2% 3.7 90.75sec 10996 0 Direct 3.7 9038 18085 11019 21.9%

Stats Details: Dreadfire Vessel

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 3.73 3.72 0.00 0.00 0.0000 0.0000 41039.87 41039.87 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 78.06% 2.91 0 4 9038.33 8937 9474 8992.99 0 9474 26268 26268 0.00%
crit 21.94% 0.82 0 4 18084.67 17875 18947 11190.38 0 18947 14772 14772 0.00%

Action Details: Dreadfire Vessel

  • id:344732
  • school:fire
  • range:50.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:90.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:8212.26
  • base_dd_max:8212.26
  • base_dd_mult:1.00

Spelldata

  • id:344732
  • name:Dreadfire Vessel
  • school:fire
  • tooltip:
  • description:Unleash incendiary flames at your target inflicting {$s1=0} Fire damage.
Eternal Skirmish 40 0.4% 21.8 13.36sec 547 0 Direct 21.8 446 892 547 22.5%

Stats Details: Eternal Skirmish

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 21.76 21.76 0.00 0.00 0.0000 0.0000 11894.83 11894.83 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 77.47% 16.86 6 31 446.23 435 485 446.24 435 460 7522 7522 0.00%
crit 22.53% 4.90 0 14 892.26 871 969 889.44 0 969 4373 4373 0.00%

Action Details: Eternal Skirmish

  • id:323889
  • school:shadow
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:400.00
  • base_dd_max:400.00
  • base_dd_mult:1.00

Spelldata

  • id:323889
  • name:Eternal Skirmish
  • school:shadow
  • tooltip:
  • description:Deals {$s1=400} Shadow damage.
Kill Shot 79 0.7% 4.4 14.31sec 5455 4551 Direct 4.3 4244 9567 5504 23.6%

Stats Details: Kill Shot

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 4.36 4.33 0.00 0.00 1.1987 0.0000 23810.85 34011.41 29.99% 4551.00 4551.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 76.43% 3.31 0 7 4244.07 4065 4838 4204.75 0 4838 14044 20060 29.77%
crit 23.57% 1.02 0 4 9566.60 9146 10885 6412.29 0 10885 9767 13951 20.11%

Action Details: Kill Shot

  • id:53351
  • school:physical
  • range:40.0
  • travel_speed:80.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:10.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:focus
  • base_cost:10.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:53351
  • name:Kill Shot
  • school:physical
  • tooltip:
  • description:You attempt to finish off a wounded target, dealing {$s1=0} Physical damage. Only usable on enemies with less than {$s2=20}% health.

Action Priority List

    trickshots
    [N]:4.36
  • if_expr:buff.dead_eye.down
Master Marksman 510 4.6% 344.2 0.88sec 444 0 Periodic 546.9 279 0 279 0.0% 72.9%

Stats Details: Master Marksman

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 344.15 0.00 546.90 546.90 0.0000 2.0000 152714.98 152714.98 0.00% 139.62 0.00
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 100.00% 546.90 401 691 279.16 46 2543 279.43 220 342 152715 152715 0.00%

Action Details: Master Marksman

  • id:269576
  • school:physical
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:false
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:6.00
  • base_tick_time:2.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH

Spelldata

  • id:269576
  • name:Master Marksman
  • school:physical
  • tooltip:Bleeding for $w1 damage every $t1 sec.
  • description:{$@spelldesc260309=Your ranged special attack critical strikes cause the target to bleed for an additional {$s1=15}% of the damage dealt over {$269576d=6 seconds}.}
Multi-Shot 2699 24.3% 83.5 3.58sec 9683 8484 Direct 416.5 1583 3167 1941 22.6%

Stats Details: Multishot

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 83.51 416.52 0.00 0.00 1.1413 0.0000 808668.81 1155102.53 29.99% 8484.26 8484.26
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 77.39% 322.33 237 413 1583.20 953 2194 1583.30 1468 1683 510380 729026 29.99%
crit 22.61% 94.18 58 134 3166.81 1905 4389 3167.08 2844 3404 298289 426076 29.99%

Action Details: Multishot

  • id:257620
  • school:physical
  • range:40.0
  • travel_speed:50.0000
  • radius:10.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:5
  • harmful:true

Resources

  • resource:focus
  • base_cost:20.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:257620
  • name:Multi-Shot
  • school:physical
  • tooltip:
  • description:Fires several missiles, hitting your current target and up to $I enemies within $A1 yards for {$s1=0} Physical damage.

Action Priority List

    trickshots
    [M]:76.31
  • if_expr:buff.trick_shots.down|buff.precise_shots.up&focus>cost+action.aimed_shot.cost&(!talent.chimaera_shot|active_enemies>3)
    trickshots
    [O]:7.20
  • if_expr:focus>cost+action.aimed_shot.cost
Rapid Fire 1813 16.3% 21.8 13.71sec 24926 14290 Periodic 788.4 561 1123 689 22.7% 2.2%

Stats Details: Rapid Fire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 21.79 0.00 158.18 788.44 1.7443 0.2056 543113.05 775782.69 29.99% 14290.19 14290.19
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 77.29% 609.42 398 843 561.23 439 1156 561.41 545 579 342031 488556 29.99%
crit 22.71% 179.02 114 258 1123.19 878 2313 1123.62 1016 1214 201082 287226 29.99%

Action Details: Rapid Fire

  • id:257044
  • school:physical
  • range:40.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:20.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:false
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:2.00
  • base_tick_time:0.33
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH

Spelldata

  • id:257044
  • name:Rapid Fire
  • school:physical
  • tooltip:Being targeted by Rapid Fire.
  • description:Shoot a stream of {$s1=7} shots at your target over {$d=2 seconds}, dealing a total of ${$m1*$257045sw1} Physical damage. {$?s321281=true}[ Each shot generates {$263585s1=1} Focus.][] Usable while moving.

Action Details: Rapid Fire Damage

  • id:257045
  • school:physical
  • range:40.0
  • travel_speed:40.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:on_hit
  • energize_resource:focus
  • energize_amount:1.0

Spelldata

  • id:257045
  • name:Rapid Fire
  • school:physical
  • tooltip:
  • description:{$@spelldesc257044=Shoot a stream of {$s1=7} shots at your target over {$d=2 seconds}, dealing a total of ${$m1*$257045sw1} Physical damage. {$?s321281=true}[ Each shot generates {$263585s1=1} Focus.][] Usable while moving.}

Action Priority List

    trickshots
    [J]:20.94
  • if_expr:buff.trick_shots.remains>=execute_time&runeforge.surging_shots&buff.double_tap.down
    trickshots
    [L]:0.86
  • if_expr:buff.trick_shots.remains>=execute_time
Shadowcore Oil Blast 44 0.4% 43.6 6.84sec 301 0 Direct 43.6 245 491 301 22.7%

Stats Details: Shadowcore Oil Blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 43.58 43.58 0.00 0.00 0.0000 0.0000 13125.87 13125.87 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 77.30% 33.69 17 53 245.47 239 266 245.48 242 250 8270 8270 0.00%
crit 22.70% 9.89 2 21 490.88 479 533 490.82 479 512 4856 4856 0.00%

Action Details: Shadowcore Oil Blast

  • id:336463
  • school:shadow
  • range:60.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:220.00
  • base_dd_max:220.00
  • base_dd_mult:1.00

Spelldata

  • id:336463
  • name:Shadowcore Oil Blast
  • school:shadow
  • tooltip:
  • description:Deals {$s1=220} Shadow damage.
Steady Shot 317 2.9% 60.4 4.94sec 1574 1160 Direct 61.3 1260 2520 1551 23.1%

Stats Details: Steady Shot

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 60.35 61.26 0.00 0.00 1.3574 0.0000 95022.66 135730.36 29.99% 1159.87 1159.87
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 76.87% 47.09 31 68 1259.65 1219 1605 1259.28 1224 1289 59323 84737 29.99%
crit 23.13% 14.17 3 29 2519.82 2439 3210 2518.87 2439 2677 35700 50993 29.99%

Action Details: Steady Shot

  • id:56641
  • school:physical
  • range:40.0
  • travel_speed:75.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:1.75
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:on_cast
  • energize_resource:focus
  • energize_amount:10.0

Spelldata

  • id:56641
  • name:Steady Shot
  • school:physical
  • tooltip:
  • description:A steady shot that causes {$s1=0} Physical damage. Usable while moving.{$?s321018=true}[ |cFFFFFFFFGenerates {$s2=0} Focus.][]

Action Priority List

    trickshots
    [F]:15.71
  • if_expr:talent.steady_focus&in_flight&buff.steady_focus.remains<5
    trickshots
    [P]:44.89
Wild Spirits 49 (1353) 0.4% (12.1%) 3.0 120.64sec 135246 123004 Direct 14.9 (225.5) 807 1616 987 22.3% (22.5%)

Stats Details: Wild Spirits

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.98 14.85 0.00 0.00 1.0997 0.0000 14667.31 14667.31 0.00% 123003.73 123003.73
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 77.74% 11.55 4 15 807.49 776 910 807.64 784 852 9323 9323 0.00%
crit 22.26% 3.31 0 9 1616.13 1552 1820 1573.16 0 1820 5344 5344 0.00%

Action Details: Wild Spirits

  • id:328231
  • school:nature
  • range:40.0
  • travel_speed:30.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:120.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:328231
  • name:Wild Spirits
  • school:nature
  • tooltip:
  • description:Evoke the energy of Wild Spirits at the target location, dealing {$328837s3=0} Nature damage and apply Hunter's Mark to all enemy targets within the area for {$328837d=15 seconds}. While the Wild Spirits are active, each damaging ability you or your pet use against a target in the area will strike up to $328757I nearby targets for {$328757s1=0} Nature damage.

Action Details: Wild Spirits Damage

  • id:328837
  • school:nature
  • range:100.0
  • travel_speed:0.0000
  • radius:12.0
  • trigger_gcd:0.0000
  • gcd_type:attack_haste
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:328837
  • name:Wild Spirits
  • school:nature
  • tooltip:
  • description:{$@spelldesc328231=Evoke the energy of Wild Spirits at the target location, dealing {$328837s3=0} Nature damage and apply Hunter's Mark to all enemy targets within the area for {$328837d=15 seconds}. While the Wild Spirits are active, each damaging ability you or your pet use against a target in the area will strike up to $328757I nearby targets for {$328757s1=0} Nature damage.}

Action Priority List

    trickshots
    [H]:2.98
    Wild Spirits (_proc) 1304 11.6% 42.1 6.13sec 9218 0 Direct 210.6 1504 3009 1844 22.6%

Stats Details: Wild Spirits Proc

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 42.12 210.62 0.00 0.00 0.0000 0.0000 388292.91 388292.91 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 77.45% 163.12 102 189 1503.96 1355 1699 1504.63 1482 1544 245328 245328 0.00%
crit 22.55% 47.50 23 73 3009.36 2711 3398 3010.46 2923 3123 142965 142965 0.00%

Action Details: Wild Spirits Proc

  • id:328757
  • school:nature
  • range:40.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:attack_haste
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:5
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:328757
  • name:Wild Spirits
  • school:nature
  • tooltip:
  • description:{$@spelldesc328231=Evoke the energy of Wild Spirits at the target location, dealing {$328837s3=0} Nature damage and apply Hunter's Mark to all enemy targets within the area for {$328837d=15 seconds}. While the Wild Spirits are active, each damaging ability you or your pet use against a target in the area will strike up to $328757I nearby targets for {$328757s1=0} Nature damage.}
Simple Action Stats Execute Interval
surging_shots
Veiled Augmentation (augmentation) 1.0 0.00sec

Stats Details: Augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Augmentation

  • id:347901
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:surging_shots
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Blood Fury 3.0 120.76sec

Stats Details: Blood Fury

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.97 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Blood Fury

  • id:20572
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:120.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:20572
  • name:Blood Fury
  • school:physical
  • tooltip:Attack power increased by $w1.
  • description:Increases your attack power by {$s1=122} for {$d=15 seconds}.

Action Priority List

    cds
    [D]:2.97
  • if_expr:buff.trueshot.up|target.time_to_die<16
Double Tap 5.6 60.60sec

Stats Details: Double Tap

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 5.60 0.00 0.00 0.00 0.9773 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Double Tap

  • id:260402
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:60.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:260402
  • name:Double Tap
  • school:physical
  • tooltip:Your next Aimed Shot will fire a second time instantly at {$s4=100}% power and consume no Focus, or your next Rapid Fire will shoot {$s3=100}% additional shots during its channel.
  • description:Your next Aimed Shot will fire a second time instantly at {$s4=100}% power without consuming Focus, or your next Rapid Fire will shoot {$s3=100}% additional shots during its channel.

Action Priority List

    trickshots
    [G]:4.61
  • if_expr:covenant.kyrian&cooldown.resonating_arrow.remains<gcd|cooldown.rapid_fire.remains<cooldown.aimed_shot.full_recharge_time|!(talent.streamline&runeforge.surging_shots)|!covenant.kyrian
Spectral Flask of Power (flask) 1.0 0.00sec

Stats Details: Flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Flask

  • id:307185
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:surging_shots
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Feast of Gluttonous Hedonism (food) 1.0 0.00sec

Stats Details: Food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Food

  • id:308462
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:surging_shots
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Potion of Spectral Agility (potion) 1.5 309.88sec

Stats Details: Potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.48 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Potion

  • id:307159
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:300.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Action Priority List

    cds
    [E]:1.47
  • if_expr:buff.trueshot.up&buff.bloodlust.up|buff.trueshot.up&target.health.pct<20|target.time_to_die<26
Trueshot 3.0 120.78sec

Stats Details: Trueshot

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.97 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Trueshot

  • id:288613
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:attack_haste
  • min_gcd:0.0000
  • cooldown:120.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:288613
  • name:Trueshot
  • school:physical
  • tooltip:The cooldown of Aimed Shot and Rapid Fire is reduced by ${$m1/4}%, and Aimed Shot casts {$s4=50}% faster. All Focus generation is increased by {$s5=50}%.
  • description:Reduces the cooldown of your Aimed Shot and Rapid Fire by ${$m1/4}%, and causes Aimed Shot to cast {$s4=50}% faster for {$d=15 seconds}. While Trueshot is active, you generate {$s5=50}% additional Focus.

Action Priority List

    trickshots
    [I]:2.97

Buffs

Dynamic Buffs Start Refresh Interval Trigger Avg Dur Up-Time Benefit Overflow Expiry
Blood Fury 3.0 0.0 120.8sec 120.8sec 14.7sec 14.64% 0.00% 0.0 (0.0) 2.8

Buff Details

  • buff initial source:surging_shots
  • cooldown name:buff_blood_fury
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:120.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:attack_power
  • amount:122.00

Trigger Details

  • interval_min/max:120.0s / 122.9s
  • trigger_min/max:120.0s / 122.9s
  • trigger_pct:100.00%
  • duration_min/max:0.2s / 15.0s

Stack Uptimes

  • blood_fury_1:14.64%

Spelldata

  • id:20572
  • name:Blood Fury
  • tooltip:Attack power increased by $w1.
  • description:Increases your attack power by {$s1=122} for {$d=15 seconds}.
  • max_stacks:0
  • duration:15.00
  • cooldown:120.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 40.0sec 13.52% 0.00% 0.0 (0.0) 1.0

Buff Details

  • buff initial source:surging_shots
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • base duration:40.00
  • duration modifier:1.00
  • base cooldown:300.00
  • default_chance:100.00%
  • default_value:0.30
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:40.0s / 40.0s

Stack Uptimes

  • bloodlust_1:13.52%

Spelldata

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by $w1%.
  • description:Increases haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Double Tap 5.6 0.0 58.4sec 60.6sec 4.4sec 8.28% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:surging_shots
  • cooldown name:buff_double_tap
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.50
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:50.0s / 62.7s
  • trigger_min/max:60.0s / 62.7s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 11.2s

Stack Uptimes

  • double_tap_1:8.28%

Spelldata

  • id:260402
  • name:Double Tap
  • tooltip:Your next Aimed Shot will fire a second time instantly at {$s4=100}% power and consume no Focus, or your next Rapid Fire will shoot {$s3=100}% additional shots during its channel.
  • description:Your next Aimed Shot will fire a second time instantly at {$s4=100}% power without consuming Focus, or your next Rapid Fire will shoot {$s3=100}% additional shots during its channel.
  • max_stacks:0
  • duration:15.00
  • cooldown:60.00
  • default_chance:0.00%
Well Fed (feast_of_gluttonous_hedonism) 1.0 0.0 0.0sec 0.0sec 300.0sec 100.00% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:surging_shots
  • cooldown name:buff_feast_of_gluttonous_hedonism
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:agility
  • amount:20.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:240.1s / 359.8s

Stack Uptimes

  • feast_of_gluttonous_hedonism_1:100.00%

Spelldata

  • id:327709
  • name:Well Fed
  • tooltip:Agility increased by $w1.
  • description:Agility increased by {$s1=20}. Lasts {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Lock and Load 8.3 0.2 32.2sec 31.4sec 2.4sec 6.55% 18.13% 0.2 (0.2) 0.0

Buff Details

  • buff initial source:surging_shots
  • cooldown name:buff_lock_and_load
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:8.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:1.8s / 255.4s
  • trigger_min/max:1.8s / 255.4s
  • trigger_pct:8.11%
  • duration_min/max:0.0s / 10.2s

Stack Uptimes

  • lock_and_load_1:6.55%

Spelldata

  • id:194594
  • name:Lock and Load
  • tooltip:Aimed Shot costs no Focus and is instant.
  • description:{$@spelldesc194595=Your ranged auto attacks have a {$194595h=8}% chance to trigger Lock and Load, causing your next Aimed Shot to cost no Focus and be instant.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%

Trigger Spelldata

  • id:194595
  • name:Lock and Load
  • tooltip:
  • description:Your ranged auto attacks have a {$194595h=8}% chance to trigger Lock and Load, causing your next Aimed Shot to cost no Focus and be instant.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:8.00%
Potion of Spectral Agility 1.5 0.0 309.3sec 309.3sec 23.3sec 11.25% 0.00% 0.0 (0.0) 1.2

Buff Details

  • buff initial source:surging_shots
  • cooldown name:buff_potion_of_spectral_agility
  • max_stacks:1
  • base duration:25.00
  • duration modifier:1.00
  • base cooldown:1.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:agility
  • amount:190.00

Trigger Details

  • interval_min/max:300.0s / 332.5s
  • trigger_min/max:300.0s / 332.5s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 25.0s

Stack Uptimes

  • potion_of_spectral_agility_1:11.25%

Spelldata

  • id:307159
  • name:Potion of Spectral Agility
  • tooltip:Agility increased by $w1.
  • description:Increases your Agility by {$s1=190} for {$d=25 seconds}.
  • max_stacks:0
  • duration:25.00
  • cooldown:1.00
  • default_chance:0.00%
Precise Shots 41.6 3.0 7.2sec 6.7sec 2.4sec 33.96% 77.72% 1.5 (1.5) 0.0

Buff Details

  • buff initial source:surging_shots
  • cooldown name:buff_precise_shots
  • max_stacks:2
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.50
  • default_chance:101.00%
  • default_value:0.75
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.9s / 23.4s
  • trigger_min/max:0.9s / 15.3s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 20.2s

Stack Uptimes

  • precise_shots_1:30.00%
  • precise_shots_2:3.96%

Spelldata

  • id:260242
  • name:Precise Shots
  • tooltip:Damage of {$?s342049=false}[Chimaera Shot][Arcane Shot] or Multi-Shot increased by {$s1=75}%.
  • description:{$@spelldesc260240=Aimed Shot causes your next 1-{$260242u=2} {$?s342049=false}[Chimaera Shots][Arcane Shots] or Multi-Shots to deal {$260242s1=75}% more damage.}
  • max_stacks:2
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
Spectral Flask of Power 1.0 0.0 0.0sec 0.0sec 300.0sec 100.00% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:surging_shots
  • cooldown name:buff_spectral_flask_of_power
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:agility
  • amount:70.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:240.1s / 359.8s

Stack Uptimes

  • spectral_flask_of_power_1:100.00%

Spelldata

  • id:307185
  • name:Spectral Flask of Power
  • tooltip:$pri increased by $w1.
  • description:Increases $pri by {$s1=70} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Steady Focus 7.4 15.9 42.4sec 13.0sec 36.8sec 91.33% 0.00% 15.9 (15.9) 6.6

Buff Details

  • buff initial source:surging_shots
  • cooldown name:buff_steady_focus
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.07
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:15.0s / 243.3s
  • trigger_min/max:4.0s / 60.7s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 242.2s

Stack Uptimes

  • steady_focus_1:91.33%

Spelldata

  • id:193534
  • name:Steady Focus
  • tooltip:Haste increased by {$s1=7}%.
  • description:{$@spelldesc193533=Using Steady Shot twice in a row increases your Haste by {$193534s1=7}% for {$193534d=15 seconds}.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%

Trigger Spelldata

  • id:193533
  • name:Steady Focus
  • tooltip:
  • description:Using Steady Shot twice in a row increases your Haste by {$193534s1=7}% for {$193534d=15 seconds}.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
Trick Shots 67.2 16.4 4.5sec 3.6sec 4.0sec 89.92% 100.00% 16.4 (16.4) 0.0

Buff Details

  • buff initial source:surging_shots
  • cooldown name:buff_trick_shots
  • max_stacks:1
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:1.8s / 12.3s
  • trigger_min/max:0.9s / 10.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 12.3s

Stack Uptimes

  • trick_shots_1:89.92%

Spelldata

  • id:257622
  • name:Trick Shots
  • tooltip:Your next Aimed Shot or Rapid Fire will ricochet and hit {$257621s1=5} additional targets for {$257621s4=50}% of normal damage.
  • description:{$@spelldesc257621=When Multi-Shot hits {$s2=3} or more targets, your next Aimed Shot or Rapid Fire will ricochet and hit up to {$s1=5} additional targets for {$s4=50}% of normal damage.}
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
Trueshot 3.0 0.0 120.8sec 120.8sec 19.1sec 18.98% 0.00% 0.0 (0.0) 2.8

Buff Details

  • buff initial source:surging_shots
  • cooldown name:buff_trueshot
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.31
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.50
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:120.0s / 122.9s
  • trigger_min/max:120.0s / 122.9s
  • trigger_pct:100.00%
  • duration_min/max:0.2s / 19.7s

Stack Uptimes

  • trueshot_1:18.98%

Spelldata

  • id:288613
  • name:Trueshot
  • tooltip:The cooldown of Aimed Shot and Rapid Fire is reduced by ${$m1/4}%, and Aimed Shot casts {$s4=50}% faster. All Focus generation is increased by {$s5=50}%.
  • description:Reduces the cooldown of your Aimed Shot and Rapid Fire by ${$m1/4}%, and causes Aimed Shot to cast {$s4=50}% faster for {$d=15 seconds}. While Trueshot is active, you generate {$s5=50}% additional Focus.
  • max_stacks:0
  • duration:15.00
  • cooldown:120.00
  • default_chance:0.00%
Veiled Augmentation 1.0 0.0 0.0sec 0.0sec 300.0sec 100.00% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:surging_shots
  • cooldown name:buff_veiled_augmentation
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:agility
  • amount:18.00
  • stat:strength
  • amount:18.00
  • stat:intellect
  • amount:18.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:240.1s / 359.8s

Stack Uptimes

  • veiled_augmentation_1:100.00%

Spelldata

  • id:347901
  • name:Veiled Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=18} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Wild Spirits 3.0 0.0 120.6sec 120.6sec 17.5sec 17.43% 0.00% 0.0 (0.0) 2.8

Buff Details

  • buff initial source:surging_shots
  • cooldown name:buff_wild_spirits
  • max_stacks:1
  • base duration:18.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:120.0s / 122.7s
  • trigger_min/max:120.0s / 122.7s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 18.0s

Stack Uptimes

  • wild_spirits_1:17.43%

Spelldata

  • id:328837
  • name:Wild Spirits
  • tooltip:
  • description:{$@spelldesc328231=Evoke the energy of Wild Spirits at the target location, dealing {$328837s3=0} Nature damage and apply Hunter's Mark to all enemy targets within the area for {$328837d=15 seconds}. While the Wild Spirits are active, each damaging ability you or your pet use against a target in the area will strike up to $328757I nearby targets for {$328757s1=0} Nature damage.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
Windfury Totem 1.0 0.0 0.0sec 0.0sec 300.0sec 100.00% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:surging_shots
  • cooldown name:buff_windfury_totem
  • max_stacks:1
  • base duration:900.00
  • duration modifier:1.00
  • base cooldown:0.50
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:240.1s / 359.8s

Stack Uptimes

  • windfury_totem_1:100.00%

Spelldata

  • id:327942
  • name:Windfury Totem
  • tooltip:Your auto-attacks have a {$h=10}% chance to instantly attack again.
  • description:{$@spelldesc8512=Summons a Windfury Totem with {$s1=5} health at the feet of the caster for {$d=120 seconds}. Party members within {$s2=30} yds have a {$327942h=10}% chance when they auto-attack to swing an extra time.}
  • max_stacks:0
  • duration:120.00
  • cooldown:0.00
  • default_chance:10.00%
Constant Buffs
Arcane Intellect

Buff Details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff Details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:15.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
Power Word: Fortitude

Buff Details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.$?$w2>0[ Magic damage taken reduced by $w2%.][]
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Procs, Uptimes & Benefits

Proc Count Min Max Interval Min Max
double_tap_aimed 4.7 2.0 7.0 68.1s 47.1s 291.7s
Surging Shots Rapid Fire reset 6.8 0.0 15.0 38.5s 2.4s 343.0s
double_tap_rapid_fire 0.9 0.0 4.0 102.6s 55.2s 247.1s
Uptime Avg % Min Max Avg Dur Min Max
Focus Cap 1.19% 0.68% 2.53% 0.7s 0.0s 2.4s

Cooldown waste details

Seconds per ExecuteSeconds per Iteration
AbilityAverageMinimumMaximumAverageMinimumMaximum
Double Tap0.7080.0012.6762.6810.0008.692
Aimed Shot2.0310.0019.97921.4309.00137.369
Kill Shot4.4100.00128.50413.5190.00033.700
Wild Spirits0.7740.0012.7031.2740.0004.312
Trueshot0.8200.0012.8891.5480.2714.586
Rapid Fire1.3960.0018.99226.19310.96547.024

Resources

Gains Type Count Total Tot% Avg Overflow Ovr%
surging_shots
steady_shot Focus 61.35 593.51 20.29% 9.67 20.02 3.26%
rapid_fire Focus 158.19 154.34 5.28% 0.98 3.85 2.43%
focus_regen Focus 621.30 1933.64 66.10% 3.11 26.71 1.36%
Trueshot Focus 205.85 243.81 8.33% 1.18 6.60 2.63%
Change Start Gain/s Loss/s Overflow (Total) End (Avg) Min Max
Focus 100.0 9.75 9.96 57.2 38.0 0.0 100.0
Usage Type Count Total Avg RPE APR
surging_shots
aimed_shot Focus 44.6 1273.6 28.6 28.6 893.3
kill_shot Focus 4.4 43.6 10.0 10.0 545.8
multishot Focus 83.5 1670.1 20.0 20.0 484.2

Statistics & Data Analysis

Fight Length
surging_shots Fight Length
Count 1217
Mean 299.97
Minimum 240.10
Maximum 359.83
Spread ( max - min ) 119.74
Range [ ( max - min ) / 2 * 100% ] 19.96%
DPS
surging_shots Damage Per Second
Count 1217
Mean 11136.69
Minimum 10153.25
Maximum 12210.06
Spread ( max - min ) 2056.81
Range [ ( max - min ) / 2 * 100% ] 9.23%
Standard Deviation 350.5101
5th Percentile 10569.97
95th Percentile 11723.12
( 95th Percentile - 5th Percentile ) 1153.15
Mean Distribution
Standard Deviation 10.0474
95.00% Confidence Interval ( 11117.00 - 11156.39 )
Normalized 95.00% Confidence Interval ( 99.82% - 100.18% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 39
0.1% Error 3806
0.1 Scale Factor Error with Delta=300 1049
0.05 Scale Factor Error with Delta=300 4196
0.01 Scale Factor Error with Delta=300 104879
Priority Target DPS
surging_shots Priority Target Damage Per Second
Count 1217
Mean 3802.85
Minimum 3411.99
Maximum 4243.70
Spread ( max - min ) 831.72
Range [ ( max - min ) / 2 * 100% ] 10.94%
Standard Deviation 127.5843
5th Percentile 3594.26
95th Percentile 4023.82
( 95th Percentile - 5th Percentile ) 429.56
Mean Distribution
Standard Deviation 3.6572
95.00% Confidence Interval ( 3795.68 - 3810.02 )
Normalized 95.00% Confidence Interval ( 99.81% - 100.19% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 44
0.1% Error 4324
0.1 Scale Factor Error with Delta=300 139
0.05 Scale Factor Error with Delta=300 556
0.01 Scale Factor Error with Delta=300 13896
DPS(e)
surging_shots Damage Per Second (Effective)
Count 1217
Mean 11136.69
Minimum 10153.25
Maximum 12210.06
Spread ( max - min ) 2056.81
Range [ ( max - min ) / 2 * 100% ] 9.23%
Damage
surging_shots Damage
Count 1217
Mean 3333610.61
Minimum 2515479.19
Maximum 4063864.52
Spread ( max - min ) 1548385.33
Range [ ( max - min ) / 2 * 100% ] 23.22%
DTPS
surging_shots Damage Taken Per Second
Count 1217
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
surging_shots Healing Per Second
Count 1217
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
surging_shots Healing Per Second (Effective)
Count 1217
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
surging_shots Heal
Count 1217
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
surging_shots Healing Taken Per Second
Count 1217
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
surging_shots Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
surging_shotsTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
surging_shots Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask
1 0.00 augmentation
2 0.00 food
3 0.00 snapshot_stats
Snapshot raid buffed stats before combat begins and pre-potting is done.
4 0.00 tar_trap,if=runeforge.soulforge_embers
5 0.00 double_tap,precast_time=10,if=!covenant.kyrian&(!talent.volley|active_enemies<2)
6 0.00 aimed_shot,if=active_enemies<3
7 0.00 steady_shot,if=active_enemies>2
Default action list Executed every time the actor is available.
# count action,conditions
8 1.00 auto_shot
0.00 counter_shot,line_cd=30,if=runeforge.sephuzs_proclamation|soulbind.niyas_tools_poison|(conduit.reversal_of_fortune&!runeforge.sephuzs_proclamation)
9 3.74 use_items
A 0.00 call_action_list,name=cds
B 0.00 call_action_list,name=st,if=active_enemies<3
C 0.00 call_action_list,name=trickshots,if=active_enemies>2
actions.cds
# count action,conditions
0.00 berserking,if=buff.trueshot.up|target.time_to_die<13
D 2.97 blood_fury,if=buff.trueshot.up|target.time_to_die<16
0.00 ancestral_call,if=buff.trueshot.up|target.time_to_die<16
0.00 fireblood,if=buff.trueshot.up|target.time_to_die<9
0.00 lights_judgment,if=buff.trueshot.down
0.00 bag_of_tricks,if=buff.trueshot.down
E 1.47 potion,if=buff.trueshot.up&buff.bloodlust.up|buff.trueshot.up&target.health.pct<20|target.time_to_die<26
actions.trickshots
# count action,conditions
F 15.71 steady_shot,if=talent.steady_focus&in_flight&buff.steady_focus.remains<5
G 4.61 double_tap,if=covenant.kyrian&cooldown.resonating_arrow.remains<gcd|cooldown.rapid_fire.remains<cooldown.aimed_shot.full_recharge_time|!(talent.streamline&runeforge.surging_shots)|!covenant.kyrian
0.00 tar_trap,if=runeforge.soulforge_embers&tar_trap.remains<gcd&cooldown.flare.remains<gcd
0.00 flare,if=tar_trap.up&runeforge.soulforge_embers
0.00 explosive_shot
H 2.98 wild_spirits
0.00 resonating_arrow
0.00 volley
0.00 barrage
I 2.97 trueshot
J 20.94 rapid_fire,if=buff.trick_shots.remains>=execute_time&runeforge.surging_shots&buff.double_tap.down
K 44.75 aimed_shot,target_if=min:(dot.serpent_sting.remains<?action.serpent_sting.in_flight_to_target*dot.serpent_sting.duration),if=buff.trick_shots.remains>=execute_time&(buff.precise_shots.down|full_recharge_time<cast_time+gcd|buff.trueshot.up)
0.00 death_chakram,if=focus+cast_regen<focus.max
L 0.86 rapid_fire,if=buff.trick_shots.remains>=execute_time
M 76.31 multishot,if=buff.trick_shots.down|buff.precise_shots.up&focus>cost+action.aimed_shot.cost&(!talent.chimaera_shot|active_enemies>3)
0.00 chimaera_shot,if=buff.precise_shots.up&focus>cost+action.aimed_shot.cost&active_enemies<4
N 4.36 kill_shot,if=buff.dead_eye.down
0.00 a_murder_of_crows
0.00 flayed_shot
0.00 serpent_sting,target_if=min:dot.serpent_sting.remains,if=refreshable
O 7.20 multishot,if=focus>cost+action.aimed_shot.cost
P 44.89 steady_shot

Sample Sequence

0125789FHIDEMKMJMKMKMJMPFKMJMKMKPMPFJMKMPKMPMKMPFMKMPJMPFGKMPKMMKMPFJMKMPPPMKMPPMKMJ9MPPOKMJMPPKMPPMGPKMPJHIDMKMKPFMJMKMJMKMKPFMJMKPMPFMKMJMPKPFMGPOKMPP9JMKMPPOPOKMPPMJMKMPPMPKMJMPFOKMPPOPGKMKMJMHIDKMJMKPFMJMKMKMJMPFKMP9KMPPPMJMKMNPFKGMPOKMNJMKPFMKMPNPKMPFJMENKMPMKMPFNPMKMJMNPF

Sample Sequence Table

Time List # Name Target Resources Buffs
Pre precombat 0 flask surging_shots 100.0/100: 100% focus
Pre precombat 1 augmentation surging_shots 100.0/100: 100% focus
Pre precombat 2 food surging_shots 100.0/100: 100% focus
Pre precombat 5 double_tap Fluffy_Pillow 100.0/100: 100% focus
Pre precombat 7 steady_shot Fluffy_Pillow 100.0/100: 100% focus double_tap
0:00.000 default 8 auto_attack Fluffy_Pillow 100.0/100: 100% focus double_tap
0:00.000 default 9 use_items Fluffy_Pillow 100.0/100: 100% focus double_tap
0:00.000 trickshots F steady_shot Fluffy_Pillow 100.0/100: 100% focus double_tap
0:01.486 trickshots H wild_spirits Fluffy_Pillow 100.0/100: 100% focus bloodlust, double_tap, steady_focus
0:02.403 trickshots I trueshot Fluffy_Pillow 100.0/100: 100% focus bloodlust, double_tap, steady_focus
0:02.403 cds D blood_fury Fluffy_Pillow 100.0/100: 100% focus bloodlust, double_tap, steady_focus, trueshot
0:02.403 cds E potion Fluffy_Pillow 100.0/100: 100% focus bloodlust, blood_fury, double_tap, steady_focus, trueshot
0:02.403 trickshots M multishot Fluffy_Pillow 100.0/100: 100% focus bloodlust, blood_fury, double_tap, steady_focus, trueshot, potion_of_spectral_agility
0:03.320 trickshots K aimed_shot Fluffy_Pillow 91.3/100: 91% focus bloodlust, blood_fury, double_tap, steady_focus, trick_shots, trueshot, wild_spirits, potion_of_spectral_agility
0:04.236 trickshots M multishot Fluffy_Pillow 66.9/100: 67% focus bloodlust, blood_fury, precise_shots, steady_focus, trueshot, wild_spirits, potion_of_spectral_agility
0:05.152 trickshots J rapid_fire Fluffy_Pillow 58.2/100: 58% focus bloodlust, blood_fury, steady_focus, trick_shots, trueshot, wild_spirits, potion_of_spectral_agility
0:06.621 trickshots M multishot Fluffy_Pillow 86.4/100: 86% focus bloodlust, blood_fury, steady_focus, trueshot, wild_spirits, potion_of_spectral_agility
0:07.536 trickshots K aimed_shot Fluffy_Pillow 77.7/100: 78% focus bloodlust, blood_fury, steady_focus, trick_shots, trueshot, wild_spirits, potion_of_spectral_agility
0:08.451 trickshots M multishot Fluffy_Pillow 54.0/100: 54% focus bloodlust, blood_fury, precise_shots, steady_focus, trueshot, wild_spirits, potion_of_spectral_agility
0:09.366 trickshots K aimed_shot Fluffy_Pillow 45.3/100: 45% focus bloodlust, blood_fury, steady_focus, trick_shots, trueshot, wild_spirits, potion_of_spectral_agility
0:10.282 trickshots M multishot Fluffy_Pillow 21.6/100: 22% focus bloodlust, blood_fury, precise_shots, steady_focus, trueshot, wild_spirits, potion_of_spectral_agility
0:11.198 trickshots J rapid_fire Fluffy_Pillow 12.9/100: 13% focus bloodlust, blood_fury, steady_focus, trick_shots, trueshot, wild_spirits, potion_of_spectral_agility
0:12.636 trickshots M multishot Fluffy_Pillow 38.6/100: 39% focus bloodlust, blood_fury, steady_focus, trueshot, wild_spirits, potion_of_spectral_agility
0:13.551 trickshots P steady_shot Fluffy_Pillow 29.9/100: 30% focus bloodlust, blood_fury, steady_focus, trick_shots, trueshot, wild_spirits, potion_of_spectral_agility
0:14.618 trickshots F steady_shot Fluffy_Pillow 58.1/100: 58% focus bloodlust, blood_fury, steady_focus, trick_shots, trueshot, wild_spirits, potion_of_spectral_agility
0:15.683 trickshots K aimed_shot Fluffy_Pillow 86.2/100: 86% focus bloodlust, blood_fury, steady_focus, trick_shots, trueshot, wild_spirits, potion_of_spectral_agility
0:16.599 trickshots M multishot Fluffy_Pillow 62.5/100: 63% focus bloodlust, blood_fury, precise_shots, steady_focus, trueshot, wild_spirits, potion_of_spectral_agility
0:17.513 trickshots J rapid_fire Fluffy_Pillow 53.8/100: 54% focus bloodlust, steady_focus, trick_shots, trueshot, wild_spirits, potion_of_spectral_agility
0:19.025 trickshots M multishot Fluffy_Pillow 84.5/100: 84% focus bloodlust, steady_focus, trueshot, wild_spirits, potion_of_spectral_agility
0:19.941 trickshots K aimed_shot Fluffy_Pillow 75.8/100: 76% focus bloodlust, steady_focus, trick_shots, trueshot, wild_spirits, potion_of_spectral_agility
0:20.856 trickshots M multishot Fluffy_Pillow 52.1/100: 52% focus bloodlust, precise_shots, steady_focus, trueshot, potion_of_spectral_agility
0:21.771 trickshots K aimed_shot Fluffy_Pillow 43.4/100: 43% focus bloodlust, steady_focus, trick_shots, trueshot, potion_of_spectral_agility
0:22.687 trickshots P steady_shot Fluffy_Pillow 17.1/100: 17% focus bloodlust, precise_shots(2), steady_focus, potion_of_spectral_agility
0:23.754 trickshots M multishot Fluffy_Pillow 35.8/100: 36% focus bloodlust, precise_shots(2), steady_focus, potion_of_spectral_agility
0:24.670 trickshots P steady_shot Fluffy_Pillow 23.4/100: 23% focus bloodlust, precise_shots, steady_focus, trick_shots, potion_of_spectral_agility
0:25.739 trickshots F steady_shot Fluffy_Pillow 42.2/100: 42% focus bloodlust, precise_shots, steady_focus, trick_shots, potion_of_spectral_agility
0:26.805 trickshots J rapid_fire Fluffy_Pillow 60.9/100: 61% focus bloodlust, precise_shots, steady_focus, trick_shots, potion_of_spectral_agility
0:28.268 trickshots M multishot Fluffy_Pillow 80.0/100: 80% focus bloodlust, precise_shots, steady_focus
0:29.185 trickshots K aimed_shot Fluffy_Pillow 67.5/100: 68% focus bloodlust, steady_focus, trick_shots
0:30.707 trickshots M multishot Fluffy_Pillow 45.0/100: 45% focus bloodlust, precise_shots, steady_focus
0:31.624 trickshots P steady_shot Fluffy_Pillow 32.6/100: 33% focus bloodlust, steady_focus, trick_shots
0:32.691 trickshots K aimed_shot Fluffy_Pillow 51.4/100: 51% focus bloodlust, steady_focus, trick_shots
0:34.215 trickshots M multishot Fluffy_Pillow 28.9/100: 29% focus bloodlust, precise_shots(2), steady_focus
0:35.130 trickshots P steady_shot Fluffy_Pillow 16.4/100: 16% focus bloodlust, precise_shots, steady_focus, trick_shots
0:36.197 trickshots M multishot Fluffy_Pillow 35.2/100: 35% focus bloodlust, lock_and_load, precise_shots, steady_focus, trick_shots
0:37.111 trickshots K aimed_shot Fluffy_Pillow 22.7/100: 23% focus bloodlust, lock_and_load, steady_focus, trick_shots
0:38.025 trickshots M multishot Fluffy_Pillow 30.3/100: 30% focus bloodlust, precise_shots(2), steady_focus
0:38.941 trickshots P steady_shot Fluffy_Pillow 17.8/100: 18% focus bloodlust, precise_shots, steady_focus, trick_shots
0:40.010 trickshots F steady_shot Fluffy_Pillow 36.6/100: 37% focus bloodlust, precise_shots, steady_focus, trick_shots
0:41.076 trickshots M multishot Fluffy_Pillow 55.2/100: 55% focus precise_shots, steady_focus, trick_shots
0:42.263 trickshots K aimed_shot Fluffy_Pillow 42.7/100: 43% focus steady_focus, trick_shots
0:44.242 trickshots M multishot Fluffy_Pillow 20.2/100: 20% focus precise_shots(2), steady_focus
0:45.429 trickshots P steady_shot Fluffy_Pillow 7.8/100: 8% focus precise_shots, steady_focus, trick_shots
0:46.816 trickshots J rapid_fire Fluffy_Pillow 26.5/100: 27% focus precise_shots, steady_focus, trick_shots
0:48.500 trickshots M multishot Fluffy_Pillow 44.2/100: 44% focus precise_shots, steady_focus
0:49.688 trickshots P steady_shot Fluffy_Pillow 31.7/100: 32% focus steady_focus, trick_shots
0:51.075 trickshots F steady_shot Fluffy_Pillow 50.5/100: 50% focus steady_focus, trick_shots
0:52.460 trickshots G double_tap Fluffy_Pillow 69.3/100: 69% focus steady_focus, trick_shots
0:53.650 trickshots K aimed_shot Fluffy_Pillow 76.8/100: 77% focus double_tap, steady_focus, trick_shots
0:55.630 trickshots M multishot Fluffy_Pillow 54.3/100: 54% focus precise_shots, steady_focus
0:56.819 trickshots P steady_shot Fluffy_Pillow 41.9/100: 42% focus steady_focus, trick_shots
0:58.207 trickshots K aimed_shot Fluffy_Pillow 60.6/100: 61% focus steady_focus, trick_shots
1:00.187 trickshots M multishot Fluffy_Pillow 38.2/100: 38% focus precise_shots(2), steady_focus
1:01.375 trickshots M multishot Fluffy_Pillow 25.7/100: 26% focus lock_and_load, precise_shots, steady_focus, trick_shots
1:02.562 trickshots K aimed_shot Fluffy_Pillow 13.2/100: 13% focus lock_and_load, steady_focus, trick_shots
1:03.751 trickshots M multishot Fluffy_Pillow 20.7/100: 21% focus precise_shots, steady_focus
1:04.940 trickshots P steady_shot Fluffy_Pillow 8.3/100: 8% focus steady_focus, trick_shots
1:06.327 trickshots F steady_shot Fluffy_Pillow 27.0/100: 27% focus steady_focus, trick_shots
1:07.713 trickshots J rapid_fire Fluffy_Pillow 45.7/100: 46% focus steady_focus, trick_shots
1:09.486 trickshots M multishot Fluffy_Pillow 63.9/100: 64% focus steady_focus
1:10.676 trickshots K aimed_shot Fluffy_Pillow 51.5/100: 51% focus steady_focus, trick_shots
1:12.654 trickshots M multishot Fluffy_Pillow 29.0/100: 29% focus precise_shots(2), steady_focus
1:13.843 trickshots P steady_shot Fluffy_Pillow 16.5/100: 16% focus precise_shots, steady_focus, trick_shots
1:15.229 trickshots P steady_shot Fluffy_Pillow 35.3/100: 35% focus precise_shots, steady_focus, trick_shots
1:16.616 trickshots P steady_shot Fluffy_Pillow 54.0/100: 54% focus precise_shots, steady_focus, trick_shots
1:18.002 trickshots M multishot Fluffy_Pillow 72.8/100: 73% focus precise_shots, steady_focus, trick_shots
1:19.192 trickshots K aimed_shot Fluffy_Pillow 60.4/100: 60% focus steady_focus, trick_shots
1:21.170 trickshots M multishot Fluffy_Pillow 37.9/100: 38% focus precise_shots(2), steady_focus
1:22.360 trickshots P steady_shot Fluffy_Pillow 25.4/100: 25% focus precise_shots, steady_focus, trick_shots
1:23.746 trickshots P steady_shot Fluffy_Pillow 44.2/100: 44% focus precise_shots, steady_focus, trick_shots
1:25.133 trickshots M multishot Fluffy_Pillow 63.0/100: 63% focus precise_shots, steady_focus, trick_shots
1:26.321 trickshots K aimed_shot Fluffy_Pillow 50.5/100: 50% focus steady_focus, trick_shots
1:28.480 trickshots M multishot Fluffy_Pillow 29.1/100: 29% focus precise_shots(2), steady_focus
1:29.668 trickshots J rapid_fire Fluffy_Pillow 16.7/100: 17% focus precise_shots, steady_focus, trick_shots
1:31.375 default 9 use_items Fluffy_Pillow 34.5/100: 34% focus precise_shots, steady_focus
1:31.375 trickshots M multishot Fluffy_Pillow 34.5/100: 34% focus precise_shots, steady_focus
1:32.564 trickshots P steady_shot Fluffy_Pillow 22.0/100: 22% focus steady_focus, trick_shots
1:33.950 trickshots P steady_shot Fluffy_Pillow 40.8/100: 41% focus steady_focus, trick_shots
1:35.337 trickshots O multishot Fluffy_Pillow 59.5/100: 60% focus steady_focus, trick_shots
1:36.526 trickshots K aimed_shot Fluffy_Pillow 47.1/100: 47% focus steady_focus, trick_shots
1:38.502 trickshots M multishot Fluffy_Pillow 24.6/100: 25% focus precise_shots(2), steady_focus
1:39.690 trickshots J rapid_fire Fluffy_Pillow 12.1/100: 12% focus precise_shots, steady_focus, trick_shots
1:41.550 trickshots M multishot Fluffy_Pillow 30.9/100: 31% focus precise_shots, steady_focus
1:42.738 trickshots P steady_shot Fluffy_Pillow 18.4/100: 18% focus steady_focus, trick_shots
1:44.124 trickshots P steady_shot Fluffy_Pillow 37.2/100: 37% focus steady_focus, trick_shots
1:45.510 trickshots K aimed_shot Fluffy_Pillow 55.9/100: 56% focus steady_focus, trick_shots
1:47.487 trickshots M multishot Fluffy_Pillow 33.4/100: 33% focus precise_shots(2), steady_focus
1:48.677 trickshots P steady_shot Fluffy_Pillow 21.0/100: 21% focus precise_shots, steady_focus, trick_shots
1:50.062 trickshots P steady_shot Fluffy_Pillow 39.7/100: 40% focus precise_shots, steady_focus, trick_shots
1:51.449 trickshots M multishot Fluffy_Pillow 58.5/100: 59% focus precise_shots, steady_focus, trick_shots
1:52.636 trickshots G double_tap Fluffy_Pillow 46.0/100: 46% focus steady_focus, trick_shots
1:53.824 trickshots P steady_shot Fluffy_Pillow 53.5/100: 54% focus double_tap, steady_focus, trick_shots
1:55.209 trickshots K aimed_shot Fluffy_Pillow 72.3/100: 72% focus double_tap, steady_focus, trick_shots
1:57.188 trickshots M multishot Fluffy_Pillow 49.8/100: 50% focus precise_shots, steady_focus
1:58.377 trickshots P steady_shot Fluffy_Pillow 37.4/100: 37% focus steady_focus, trick_shots
1:59.764 trickshots J rapid_fire Fluffy_Pillow 56.1/100: 56% focus steady_focus, trick_shots
2:01.552 trickshots H wild_spirits Fluffy_Pillow 74.5/100: 74% focus steady_focus
2:02.740 trickshots I trueshot Fluffy_Pillow 82.0/100: 82% focus steady_focus
2:02.740 cds D blood_fury Fluffy_Pillow 82.0/100: 82% focus steady_focus, trueshot
2:02.740 trickshots M multishot Fluffy_Pillow 82.0/100: 82% focus blood_fury, steady_focus, trueshot
2:03.930 trickshots K aimed_shot Fluffy_Pillow 73.3/100: 73% focus blood_fury, steady_focus, trick_shots, trueshot, wild_spirits
2:05.118 trickshots M multishot Fluffy_Pillow 49.6/100: 50% focus blood_fury, precise_shots(2), steady_focus, trueshot, wild_spirits
2:06.305 trickshots K aimed_shot Fluffy_Pillow 40.8/100: 41% focus blood_fury, precise_shots, steady_focus, trick_shots, trueshot, wild_spirits
2:07.493 trickshots P steady_shot Fluffy_Pillow 16.4/100: 16% focus blood_fury, precise_shots(2), trueshot, wild_spirits
2:08.978 trickshots F steady_shot Fluffy_Pillow 44.6/100: 45% focus blood_fury, precise_shots(2), trueshot, wild_spirits
2:10.460 trickshots M multishot Fluffy_Pillow 72.8/100: 73% focus blood_fury, precise_shots(2), steady_focus, trueshot, wild_spirits
2:11.649 trickshots J rapid_fire Fluffy_Pillow 64.1/100: 64% focus blood_fury, precise_shots, steady_focus, trick_shots, trueshot, wild_spirits
2:13.487 trickshots M multishot Fluffy_Pillow 91.5/100: 92% focus blood_fury, precise_shots, steady_focus, trueshot, wild_spirits
2:14.676 trickshots K aimed_shot Fluffy_Pillow 82.8/100: 83% focus blood_fury, steady_focus, trick_shots, trueshot, wild_spirits
2:15.864 trickshots M multishot Fluffy_Pillow 59.1/100: 59% focus blood_fury, precise_shots, steady_focus, trueshot, wild_spirits
2:17.053 trickshots J rapid_fire Fluffy_Pillow 50.4/100: 50% focus blood_fury, steady_focus, trick_shots, trueshot, wild_spirits
2:18.813 trickshots M multishot Fluffy_Pillow 77.1/100: 77% focus steady_focus, trueshot, wild_spirits
2:20.002 trickshots K aimed_shot Fluffy_Pillow 68.4/100: 68% focus steady_focus, trick_shots, trueshot, wild_spirits
2:21.190 trickshots M multishot Fluffy_Pillow 44.6/100: 45% focus precise_shots, steady_focus, trueshot
2:22.379 trickshots K aimed_shot Fluffy_Pillow 35.9/100: 36% focus steady_focus, trick_shots, trueshot
2:23.568 trickshots P steady_shot Fluffy_Pillow 8.5/100: 8% focus precise_shots, steady_focus
2:24.954 trickshots F steady_shot Fluffy_Pillow 27.3/100: 27% focus precise_shots, steady_focus
2:26.341 trickshots M multishot Fluffy_Pillow 45.7/100: 46% focus precise_shots, steady_focus
2:27.529 trickshots J rapid_fire Fluffy_Pillow 33.2/100: 33% focus steady_focus, trick_shots
2:29.382 trickshots M multishot Fluffy_Pillow 51.9/100: 52% focus steady_focus
2:30.572 trickshots K aimed_shot Fluffy_Pillow 39.5/100: 39% focus steady_focus, trick_shots
2:32.551 trickshots P steady_shot Fluffy_Pillow 17.0/100: 17% focus precise_shots(2), steady_focus
2:33.937 trickshots M multishot Fluffy_Pillow 35.8/100: 36% focus precise_shots(2), steady_focus
2:35.126 trickshots P steady_shot Fluffy_Pillow 23.3/100: 23% focus precise_shots, steady_focus, trick_shots
2:36.513 trickshots F steady_shot Fluffy_Pillow 42.1/100: 42% focus precise_shots, steady_focus, trick_shots
2:37.900 trickshots M multishot Fluffy_Pillow 60.8/100: 61% focus precise_shots, steady_focus, trick_shots
2:39.087 trickshots K aimed_shot Fluffy_Pillow 48.4/100: 48% focus steady_focus, trick_shots
2:41.066 trickshots M multishot Fluffy_Pillow 25.9/100: 26% focus precise_shots, steady_focus
2:42.252 trickshots J rapid_fire Fluffy_Pillow 13.4/100: 13% focus steady_focus, trick_shots
2:44.046 trickshots M multishot Fluffy_Pillow 31.7/100: 32% focus steady_focus
2:45.233 trickshots P steady_shot Fluffy_Pillow 19.3/100: 19% focus steady_focus, trick_shots
2:46.621 trickshots K aimed_shot Fluffy_Pillow 38.0/100: 38% focus steady_focus, trick_shots
2:48.600 trickshots P steady_shot Fluffy_Pillow 15.6/100: 16% focus precise_shots, steady_focus
2:49.987 trickshots F steady_shot Fluffy_Pillow 34.3/100: 34% focus precise_shots, steady_focus
2:51.377 trickshots M multishot Fluffy_Pillow 53.1/100: 53% focus precise_shots, steady_focus
2:52.564 trickshots G double_tap Fluffy_Pillow 40.7/100: 41% focus steady_focus, trick_shots
2:53.824 trickshots P steady_shot Fluffy_Pillow 48.6/100: 49% focus double_tap, steady_focus, trick_shots
2:55.210 trickshots O multishot Fluffy_Pillow 67.4/100: 67% focus double_tap, steady_focus, trick_shots
2:56.399 trickshots K aimed_shot Fluffy_Pillow 54.9/100: 55% focus double_tap, steady_focus, trick_shots
2:58.379 trickshots M multishot Fluffy_Pillow 32.5/100: 32% focus precise_shots, steady_focus
2:59.569 trickshots P steady_shot Fluffy_Pillow 20.0/100: 20% focus steady_focus, trick_shots
3:00.956 trickshots P steady_shot Fluffy_Pillow 38.8/100: 39% focus steady_focus, trick_shots
3:02.342 default 9 use_items Fluffy_Pillow 57.5/100: 58% focus steady_focus, trick_shots
3:02.342 trickshots J rapid_fire Fluffy_Pillow 57.5/100: 58% focus steady_focus, trick_shots
3:04.164 trickshots M multishot Fluffy_Pillow 76.1/100: 76% focus steady_focus
3:05.354 trickshots K aimed_shot Fluffy_Pillow 63.6/100: 64% focus steady_focus, trick_shots
3:07.334 trickshots M multishot Fluffy_Pillow 41.1/100: 41% focus precise_shots, steady_focus
3:08.522 trickshots P steady_shot Fluffy_Pillow 28.7/100: 29% focus steady_focus, trick_shots
3:09.910 trickshots P steady_shot Fluffy_Pillow 47.4/100: 47% focus steady_focus, trick_shots
3:11.298 trickshots O multishot Fluffy_Pillow 66.2/100: 66% focus steady_focus, trick_shots
3:12.487 trickshots P steady_shot Fluffy_Pillow 53.7/100: 54% focus steady_focus, trick_shots
3:13.874 trickshots O multishot Fluffy_Pillow 72.5/100: 73% focus steady_focus, trick_shots
3:15.062 trickshots K aimed_shot Fluffy_Pillow 60.0/100: 60% focus steady_focus, trick_shots
3:17.041 trickshots M multishot Fluffy_Pillow 37.6/100: 38% focus precise_shots(2), steady_focus
3:18.230 trickshots P steady_shot Fluffy_Pillow 25.1/100: 25% focus precise_shots, steady_focus, trick_shots
3:19.617 trickshots P steady_shot Fluffy_Pillow 43.9/100: 44% focus precise_shots, steady_focus, trick_shots
3:21.004 trickshots M multishot Fluffy_Pillow 62.7/100: 63% focus precise_shots, steady_focus, trick_shots
3:22.193 trickshots J rapid_fire Fluffy_Pillow 50.2/100: 50% focus steady_focus, trick_shots
3:24.161 trickshots M multishot Fluffy_Pillow 69.6/100: 70% focus steady_focus
3:25.349 trickshots K aimed_shot Fluffy_Pillow 57.2/100: 57% focus steady_focus, trick_shots
3:27.328 trickshots M multishot Fluffy_Pillow 34.7/100: 35% focus precise_shots(2), steady_focus
3:28.516 trickshots P steady_shot Fluffy_Pillow 22.2/100: 22% focus precise_shots, steady_focus, trick_shots
3:29.902 trickshots P steady_shot Fluffy_Pillow 41.0/100: 41% focus precise_shots, steady_focus, trick_shots
3:31.288 trickshots M multishot Fluffy_Pillow 59.7/100: 60% focus precise_shots, steady_focus, trick_shots
3:32.474 trickshots P steady_shot Fluffy_Pillow 47.2/100: 47% focus steady_focus, trick_shots
3:33.860 trickshots K aimed_shot Fluffy_Pillow 66.0/100: 66% focus steady_focus, trick_shots
3:35.839 trickshots M multishot Fluffy_Pillow 43.5/100: 44% focus precise_shots, steady_focus
3:37.027 trickshots J rapid_fire Fluffy_Pillow 31.1/100: 31% focus steady_focus, trick_shots
3:38.817 trickshots M multishot Fluffy_Pillow 49.4/100: 49% focus steady_focus
3:40.006 trickshots P steady_shot Fluffy_Pillow 36.9/100: 37% focus steady_focus, trick_shots
3:41.392 trickshots F steady_shot Fluffy_Pillow 55.7/100: 56% focus steady_focus, trick_shots
3:42.778 trickshots O multishot Fluffy_Pillow 74.5/100: 74% focus steady_focus, trick_shots
3:43.966 trickshots K aimed_shot Fluffy_Pillow 62.0/100: 62% focus steady_focus, trick_shots
3:45.944 trickshots M multishot Fluffy_Pillow 39.5/100: 40% focus precise_shots, steady_focus
3:47.134 trickshots P steady_shot Fluffy_Pillow 27.0/100: 27% focus steady_focus, trick_shots
3:48.521 trickshots P steady_shot Fluffy_Pillow 45.8/100: 46% focus steady_focus, trick_shots
3:49.907 trickshots O multishot Fluffy_Pillow 64.6/100: 65% focus steady_focus, trick_shots
3:51.096 trickshots P steady_shot Fluffy_Pillow 52.1/100: 52% focus steady_focus, trick_shots
3:52.483 trickshots G double_tap Fluffy_Pillow 70.9/100: 71% focus lock_and_load, steady_focus, trick_shots
3:53.824 trickshots K aimed_shot Fluffy_Pillow 79.4/100: 79% focus double_tap, lock_and_load, steady_focus, trick_shots
3:55.013 trickshots M multishot Fluffy_Pillow 86.9/100: 87% focus precise_shots, steady_focus
3:56.202 trickshots K aimed_shot Fluffy_Pillow 74.4/100: 74% focus steady_focus, trick_shots
3:58.180 trickshots M multishot Fluffy_Pillow 51.9/100: 52% focus precise_shots(2), steady_focus
3:59.368 trickshots J rapid_fire Fluffy_Pillow 39.5/100: 39% focus precise_shots, steady_focus, trick_shots
4:01.157 trickshots M multishot Fluffy_Pillow 57.8/100: 58% focus precise_shots, steady_focus
4:02.345 trickshots H wild_spirits Fluffy_Pillow 45.3/100: 45% focus steady_focus, trick_shots
4:03.534 trickshots I trueshot Fluffy_Pillow 52.8/100: 53% focus steady_focus, trick_shots
4:03.534 cds D blood_fury Fluffy_Pillow 52.8/100: 53% focus steady_focus, trick_shots, trueshot
4:03.534 trickshots K aimed_shot Fluffy_Pillow 52.8/100: 53% focus blood_fury, steady_focus, trick_shots, trueshot
4:04.721 trickshots M multishot Fluffy_Pillow 29.1/100: 29% focus blood_fury, precise_shots, steady_focus, trueshot, wild_spirits
4:05.908 trickshots J rapid_fire Fluffy_Pillow 19.7/100: 20% focus blood_fury, trick_shots, trueshot, wild_spirits
4:07.928 trickshots M multishot Fluffy_Pillow 48.7/100: 49% focus blood_fury, trueshot, wild_spirits
4:09.200 trickshots K aimed_shot Fluffy_Pillow 40.0/100: 40% focus blood_fury, trick_shots, trueshot, wild_spirits
4:10.471 trickshots P steady_shot Fluffy_Pillow 16.2/100: 16% focus blood_fury, precise_shots(2), trueshot, wild_spirits
4:11.956 trickshots F steady_shot Fluffy_Pillow 44.4/100: 44% focus blood_fury, precise_shots(2), trueshot, wild_spirits
4:13.438 trickshots M multishot Fluffy_Pillow 72.6/100: 73% focus blood_fury, precise_shots(2), steady_focus, trueshot, wild_spirits
4:14.628 trickshots J rapid_fire Fluffy_Pillow 63.9/100: 64% focus blood_fury, precise_shots, steady_focus, trick_shots, trueshot, wild_spirits
4:16.462 trickshots M multishot Fluffy_Pillow 90.3/100: 90% focus blood_fury, precise_shots, steady_focus, trueshot, wild_spirits
4:17.651 trickshots K aimed_shot Fluffy_Pillow 81.6/100: 82% focus blood_fury, steady_focus, trick_shots, trueshot, wild_spirits
4:18.839 trickshots M multishot Fluffy_Pillow 57.8/100: 58% focus precise_shots(2), steady_focus, trueshot, wild_spirits
4:20.029 trickshots K aimed_shot Fluffy_Pillow 49.1/100: 49% focus precise_shots, steady_focus, trick_shots, trueshot, wild_spirits
4:21.219 trickshots M multishot Fluffy_Pillow 25.4/100: 25% focus precise_shots(2), steady_focus, trueshot, wild_spirits
4:22.407 trickshots J rapid_fire Fluffy_Pillow 16.7/100: 17% focus precise_shots, steady_focus, trick_shots, trueshot
4:24.206 trickshots M multishot Fluffy_Pillow 40.6/100: 41% focus precise_shots, steady_focus
4:25.394 trickshots P steady_shot Fluffy_Pillow 28.1/100: 28% focus steady_focus, trick_shots
4:26.781 trickshots F steady_shot Fluffy_Pillow 46.9/100: 47% focus steady_focus, trick_shots
4:28.167 trickshots K aimed_shot Fluffy_Pillow 65.6/100: 66% focus steady_focus, trick_shots
4:30.146 trickshots M multishot Fluffy_Pillow 43.2/100: 43% focus precise_shots, steady_focus
4:31.336 trickshots P steady_shot Fluffy_Pillow 30.7/100: 31% focus steady_focus, trick_shots
4:32.723 default 9 use_items Fluffy_Pillow 49.5/100: 49% focus steady_focus, trick_shots
4:32.723 trickshots K aimed_shot Fluffy_Pillow 49.5/100: 49% focus steady_focus, trick_shots
4:34.702 trickshots M multishot Fluffy_Pillow 27.0/100: 27% focus precise_shots(2), steady_focus
4:35.891 trickshots P steady_shot Fluffy_Pillow 14.5/100: 15% focus precise_shots, steady_focus, trick_shots
4:37.277 trickshots P steady_shot Fluffy_Pillow 33.3/100: 33% focus precise_shots, steady_focus, trick_shots
4:38.663 trickshots P steady_shot Fluffy_Pillow 52.1/100: 52% focus precise_shots, steady_focus, trick_shots
4:40.052 trickshots M multishot Fluffy_Pillow 70.8/100: 71% focus precise_shots, steady_focus, trick_shots
4:41.241 trickshots J rapid_fire Fluffy_Pillow 58.4/100: 58% focus steady_focus, trick_shots
4:43.047 trickshots M multishot Fluffy_Pillow 76.8/100: 77% focus steady_focus
4:44.236 trickshots K aimed_shot Fluffy_Pillow 64.3/100: 64% focus steady_focus, trick_shots
4:46.214 trickshots M multishot Fluffy_Pillow 41.9/100: 42% focus precise_shots, steady_focus
4:47.401 trickshots N kill_shot Fluffy_Pillow 29.4/100: 29% focus steady_focus, trick_shots
4:48.589 trickshots P steady_shot Fluffy_Pillow 26.9/100: 27% focus steady_focus, trick_shots
4:49.977 trickshots F steady_shot Fluffy_Pillow 45.7/100: 46% focus steady_focus, trick_shots
4:51.362 trickshots K aimed_shot Fluffy_Pillow 64.4/100: 64% focus steady_focus, trick_shots
4:53.338 trickshots G double_tap Fluffy_Pillow 41.9/100: 42% focus precise_shots, steady_focus
4:54.525 trickshots M multishot Fluffy_Pillow 49.5/100: 49% focus double_tap, precise_shots, steady_focus
4:55.712 trickshots P steady_shot Fluffy_Pillow 37.0/100: 37% focus double_tap, steady_focus, trick_shots
4:57.099 trickshots O multishot Fluffy_Pillow 55.7/100: 56% focus double_tap, steady_focus, trick_shots
4:58.285 trickshots K aimed_shot Fluffy_Pillow 43.3/100: 43% focus double_tap, lock_and_load, steady_focus, trick_shots
4:59.474 trickshots M multishot Fluffy_Pillow 50.8/100: 51% focus precise_shots(2), steady_focus
5:00.661 trickshots N kill_shot Fluffy_Pillow 38.3/100: 38% focus precise_shots, steady_focus, trick_shots
5:01.849 trickshots J rapid_fire Fluffy_Pillow 35.8/100: 36% focus precise_shots, steady_focus, trick_shots
5:03.670 trickshots M multishot Fluffy_Pillow 54.3/100: 54% focus precise_shots, steady_focus
5:04.857 trickshots K aimed_shot Fluffy_Pillow 41.8/100: 42% focus steady_focus, trick_shots
5:06.835 trickshots P steady_shot Fluffy_Pillow 19.2/100: 19% focus precise_shots
5:08.319 trickshots F steady_shot Fluffy_Pillow 37.9/100: 38% focus precise_shots
5:09.803 trickshots M multishot Fluffy_Pillow 56.7/100: 57% focus precise_shots, steady_focus
5:10.991 trickshots K aimed_shot Fluffy_Pillow 44.2/100: 44% focus steady_focus, trick_shots
5:12.970 trickshots M multishot Fluffy_Pillow 21.8/100: 22% focus precise_shots, steady_focus
5:14.160 trickshots P steady_shot Fluffy_Pillow 9.3/100: 9% focus steady_focus, trick_shots
5:15.547 trickshots N kill_shot Fluffy_Pillow 28.1/100: 28% focus steady_focus, trick_shots
5:16.735 trickshots P steady_shot Fluffy_Pillow 25.6/100: 26% focus steady_focus, trick_shots
5:18.123 trickshots K aimed_shot Fluffy_Pillow 44.4/100: 44% focus steady_focus, trick_shots
5:20.101 trickshots M multishot Fluffy_Pillow 21.9/100: 22% focus precise_shots(2), steady_focus
5:21.288 trickshots P steady_shot Fluffy_Pillow 9.4/100: 9% focus precise_shots, steady_focus, trick_shots
5:22.676 trickshots F steady_shot Fluffy_Pillow 28.2/100: 28% focus precise_shots, steady_focus, trick_shots
5:24.062 trickshots J rapid_fire Fluffy_Pillow 47.0/100: 47% focus precise_shots, steady_focus, trick_shots
5:25.753 trickshots M multishot Fluffy_Pillow 64.7/100: 65% focus precise_shots, steady_focus
5:26.943 cds E potion Fluffy_Pillow 52.2/100: 52% focus steady_focus, trick_shots
5:26.943 trickshots N kill_shot Fluffy_Pillow 52.2/100: 52% focus steady_focus, trick_shots, potion_of_spectral_agility
5:28.132 trickshots K aimed_shot Fluffy_Pillow 49.7/100: 50% focus steady_focus, trick_shots, potion_of_spectral_agility
5:30.110 trickshots M multishot Fluffy_Pillow 27.3/100: 27% focus lock_and_load, precise_shots(2), steady_focus, potion_of_spectral_agility
5:31.298 trickshots P steady_shot Fluffy_Pillow 14.8/100: 15% focus lock_and_load, precise_shots, steady_focus, trick_shots, potion_of_spectral_agility
5:32.685 trickshots M multishot Fluffy_Pillow 33.6/100: 34% focus lock_and_load, precise_shots, steady_focus, trick_shots, potion_of_spectral_agility
5:33.874 trickshots K aimed_shot Fluffy_Pillow 21.1/100: 21% focus lock_and_load, steady_focus, trick_shots, potion_of_spectral_agility
5:35.062 trickshots M multishot Fluffy_Pillow 28.6/100: 29% focus precise_shots(2), steady_focus, potion_of_spectral_agility
5:36.251 trickshots P steady_shot Fluffy_Pillow 16.1/100: 16% focus precise_shots, steady_focus, trick_shots, potion_of_spectral_agility
5:37.636 trickshots F steady_shot Fluffy_Pillow 34.9/100: 35% focus precise_shots, steady_focus, trick_shots, potion_of_spectral_agility
5:39.022 trickshots N kill_shot Fluffy_Pillow 53.7/100: 54% focus precise_shots, steady_focus, trick_shots, potion_of_spectral_agility
5:40.212 trickshots P steady_shot Fluffy_Pillow 51.2/100: 51% focus precise_shots, steady_focus, trick_shots, potion_of_spectral_agility
5:41.598 trickshots M multishot Fluffy_Pillow 70.0/100: 70% focus precise_shots, steady_focus, trick_shots, potion_of_spectral_agility
5:42.786 trickshots K aimed_shot Fluffy_Pillow 57.5/100: 57% focus steady_focus, trick_shots, potion_of_spectral_agility
5:44.764 trickshots M multishot Fluffy_Pillow 35.0/100: 35% focus precise_shots(2), steady_focus, potion_of_spectral_agility
5:45.952 trickshots J rapid_fire Fluffy_Pillow 22.5/100: 23% focus precise_shots, steady_focus, trick_shots, potion_of_spectral_agility
5:47.791 trickshots M multishot Fluffy_Pillow 41.2/100: 41% focus precise_shots, steady_focus, potion_of_spectral_agility
5:48.979 trickshots N kill_shot Fluffy_Pillow 28.7/100: 29% focus steady_focus, trick_shots, potion_of_spectral_agility
5:50.210 trickshots P steady_shot Fluffy_Pillow 26.5/100: 26% focus steady_focus, trick_shots, potion_of_spectral_agility
5:51.598 trickshots F steady_shot Fluffy_Pillow 45.3/100: 45% focus steady_focus, trick_shots, potion_of_spectral_agility

Stats

Level Bonus (60) Race Bonus (orc) Raid-Buffed Unbuffed Gear Amount
Strength 274 3 295 277 0
Agility 450 -3 1411 1297 789 (677)
Stamina 414 1 1800 1715 1300
Intellect 369 -1 405 368 0
Spirit 0 0 0 0 0
Health 36000 34300 0
Focus 100 100 0
Spell Power 405 368 0
Crit 22.66% 22.66% 443
Haste 18.30% 18.30% 604
Versatility 3.65% 3.65% 146
Attack Power 1482 1297 0
Mastery 14.00% 14.00% 504
Armor 818 818 818
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 217.00
Local Head Helm of Insatiable Appetite
ilevel: 213, stats: { 103 Armor, +126 Sta, +92 Haste, +40 Mastery, +72 AgiInt }
Local Neck Noble's Birthstone Pendant
ilevel: 213, stats: { +71 Sta, +47 Crit, +147 Mastery }
Local Shoulders Boneshatter Pauldrons
ilevel: 235, stats: { 107 Armor, +124 Sta, +44 unknown(24), +44 unknown(25), +66 AgiInt }
item effects: { equip: Surging Shots }
Local Chest Master Huntsman's Bandolier
ilevel: 213, stats: { 137 Armor, +126 Sta, +45 Crit, +86 Mastery, +72 AgiInt }, enchant: { +20 StrAgi }
Local Waist Load-Bearing Belt
ilevel: 213, stats: { 77 Armor, +95 Sta, +69 Haste, +30 Vers, +54 AgiInt }
Local Legs Greaves of Enigmatic Energies
ilevel: 213, stats: { 120 Armor, +126 Sta, +91 Crit, +41 Mastery, +72 AgiInt }
Local Feet Stoneclas Stompers
ilevel: 213, stats: { 86 Armor, +95 Sta, +69 Crit, +30 Mastery, +54 AgiInt }, enchant: { +15 Agi }
Local Wrists Bangles of Errant Pride
ilevel: 213, stats: { 69 Armor, +71 Sta, +48 Crit, +24 Mastery, +40 AgiInt }
Local Hands Oathsworn Soldier's Gauntlets
ilevel: 220, stats: { 80 Armor, +104 Sta, +67 Crit, +36 Haste, +58 AgiInt }
Local Finger1 Most Regal Signet of Sire Denathrius
ilevel: 220, stats: { +77 Sta, +161 Haste, +44 Mastery }, enchant: { +16 Crit }
item effects: { equip: Denathrius' Privilege }
Local Finger2 Ritualist's Treasured Ring
ilevel: 213, stats: { +71 Sta, +44 Crit, +149 Haste }, enchant: { +16 Crit }
Local Trinket1 Dreadfire Vessel
ilevel: 220, stats: { +73 StrAgiInt }, enchant: shadowcore_oil
item effects: { use: Dreadfire Vessel }
Local Trinket2 Stone Legion Heraldry
ilevel: 220, stats: { +73 StrAgi }
item effects: { equip: Stone Legionnaire }
Local Back Crest of the Legionnaire General
ilevel: 220, stats: { 39 Armor, +77 Sta, +52 Haste, +24 Vers, +43 StrAgiInt }
Local Main Hand Deadeye Blunderbuss
ilevel: 220, weapon: { 121 - 227, 3 }, stats: { +77 Agi, +137 Sta, +45 Haste, +92 Mastery }, enchant: sinful_revelation

Profile

hunter="surging_shots"
source=default
spec=marksmanship
level=60
race=orc
role=attack
position=ranged_back
talents=1101032
covenant=night_fae
soulbind=140:6//188:6

# Default consumables
potion=spectral_agility
flask=spectral_flask_of_power
food=feast_of_gluttonous_hedonism
augmentation=veiled

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask
actions.precombat+=/augmentation
actions.precombat+=/food
# Snapshot raid buffed stats before combat begins and pre-potting is done.
actions.precombat+=/snapshot_stats
actions.precombat+=/tar_trap,if=runeforge.soulforge_embers
actions.precombat+=/double_tap,precast_time=10,if=!covenant.kyrian&(!talent.volley|active_enemies<2)
actions.precombat+=/aimed_shot,if=active_enemies<3
actions.precombat+=/steady_shot,if=active_enemies>2

# Executed every time the actor is available.
actions=auto_shot
actions+=/counter_shot,line_cd=30,if=runeforge.sephuzs_proclamation|soulbind.niyas_tools_poison|(conduit.reversal_of_fortune&!runeforge.sephuzs_proclamation)
actions+=/use_items
actions+=/call_action_list,name=cds
actions+=/call_action_list,name=st,if=active_enemies<3
actions+=/call_action_list,name=trickshots,if=active_enemies>2

actions.cds=berserking,if=buff.trueshot.up|target.time_to_die<13
actions.cds+=/blood_fury,if=buff.trueshot.up|target.time_to_die<16
actions.cds+=/ancestral_call,if=buff.trueshot.up|target.time_to_die<16
actions.cds+=/fireblood,if=buff.trueshot.up|target.time_to_die<9
actions.cds+=/lights_judgment,if=buff.trueshot.down
actions.cds+=/bag_of_tricks,if=buff.trueshot.down
actions.cds+=/potion,if=buff.trueshot.up&buff.bloodlust.up|buff.trueshot.up&target.health.pct<20|target.time_to_die<26

actions.st=steady_shot,if=talent.steady_focus&(prev_gcd.1.steady_shot&buff.steady_focus.remains<5|buff.steady_focus.down)
actions.st+=/kill_shot
actions.st+=/double_tap,if=covenant.kyrian&cooldown.resonating_arrow.remains<gcd|!covenant.kyrian&(cooldown.aimed_shot.up|cooldown.rapid_fire.remains>cooldown.aimed_shot.remains)
actions.st+=/flare,if=tar_trap.up&runeforge.soulforge_embers
actions.st+=/tar_trap,if=runeforge.soulforge_embers&tar_trap.remains<gcd&cooldown.flare.remains<gcd
actions.st+=/explosive_shot
actions.st+=/wild_spirits
actions.st+=/flayed_shot
actions.st+=/death_chakram,if=focus+cast_regen<focus.max
actions.st+=/volley,if=buff.precise_shots.down|!talent.chimaera_shot|active_enemies<2
actions.st+=/a_murder_of_crows
actions.st+=/resonating_arrow
actions.st+=/trueshot,if=buff.precise_shots.down|buff.resonating_arrow.up|buff.wild_spirits.up|buff.volley.up&active_enemies>1
actions.st+=/aimed_shot,target_if=min:(dot.serpent_sting.remains<?action.serpent_sting.in_flight_to_target*dot.serpent_sting.duration),if=buff.precise_shots.down|(buff.trueshot.up|full_recharge_time<gcd+cast_time)&(!talent.chimaera_shot|active_enemies<2)|buff.trick_shots.remains>execute_time&active_enemies>1
actions.st+=/rapid_fire,if=focus+cast_regen<focus.max&(buff.trueshot.down|!runeforge.eagletalons_true_focus)&(buff.double_tap.down|talent.streamline)
actions.st+=/chimaera_shot,if=buff.precise_shots.up|focus>cost+action.aimed_shot.cost
actions.st+=/arcane_shot,if=buff.precise_shots.up|focus>cost+action.aimed_shot.cost
actions.st+=/serpent_sting,target_if=min:remains,if=refreshable&target.time_to_die>duration
actions.st+=/barrage,if=active_enemies>1
actions.st+=/rapid_fire,if=focus+cast_regen<focus.max&(buff.double_tap.down|talent.streamline)
actions.st+=/steady_shot

actions.trickshots=steady_shot,if=talent.steady_focus&in_flight&buff.steady_focus.remains<5
actions.trickshots+=/double_tap,if=covenant.kyrian&cooldown.resonating_arrow.remains<gcd|cooldown.rapid_fire.remains<cooldown.aimed_shot.full_recharge_time|!(talent.streamline&runeforge.surging_shots)|!covenant.kyrian
actions.trickshots+=/tar_trap,if=runeforge.soulforge_embers&tar_trap.remains<gcd&cooldown.flare.remains<gcd
actions.trickshots+=/flare,if=tar_trap.up&runeforge.soulforge_embers
actions.trickshots+=/explosive_shot
actions.trickshots+=/wild_spirits
actions.trickshots+=/resonating_arrow
actions.trickshots+=/volley
actions.trickshots+=/barrage
actions.trickshots+=/trueshot
actions.trickshots+=/rapid_fire,if=buff.trick_shots.remains>=execute_time&runeforge.surging_shots&buff.double_tap.down
actions.trickshots+=/aimed_shot,target_if=min:(dot.serpent_sting.remains<?action.serpent_sting.in_flight_to_target*dot.serpent_sting.duration),if=buff.trick_shots.remains>=execute_time&(buff.precise_shots.down|full_recharge_time<cast_time+gcd|buff.trueshot.up)
actions.trickshots+=/death_chakram,if=focus+cast_regen<focus.max
actions.trickshots+=/rapid_fire,if=buff.trick_shots.remains>=execute_time
actions.trickshots+=/multishot,if=buff.trick_shots.down|buff.precise_shots.up&focus>cost+action.aimed_shot.cost&(!talent.chimaera_shot|active_enemies>3)
actions.trickshots+=/chimaera_shot,if=buff.precise_shots.up&focus>cost+action.aimed_shot.cost&active_enemies<4
actions.trickshots+=/kill_shot,if=buff.dead_eye.down
actions.trickshots+=/a_murder_of_crows
actions.trickshots+=/flayed_shot
actions.trickshots+=/serpent_sting,target_if=min:dot.serpent_sting.remains,if=refreshable
actions.trickshots+=/multishot,if=focus>cost+action.aimed_shot.cost
actions.trickshots+=/steady_shot

head=helm_of_insatiable_appetite,id=183001,bonus_id=7188/1485,ilevel=213
neck=nobles_birthstone_pendant,id=183039,bonus_id=7188/1485,ilevel=213
shoulders=boneshatter_pauldrons,id=172327,bonus_id=7012,ilevel=235
back=crest_of_the_legionnaire_general,id=183032,bonus_id=6805,ilevel=220
chest=master_huntsmans_bandolier,id=182988,bonus_id=6805,ilevel=213,enchant=eternal_skirmish
wrists=bangles_of_errant_pride,id=182977,bonus_id=6805,ilevel=213
hands=oathsworn_soldiers_gauntlets,id=182991,bonus_id=6805,ilevel=220
waist=loadbearing_belt,id=183016,bonus_id=6805,ilevel=213
legs=greaves_of_enigmatic_energies,id=183012,bonus_id=6805,ilevel=213
feet=stoneclas_stompers,id=183006,bonus_id=6805,ilevel=213,enchant=15agility
finger1=most_regal_signet_of_sire_denathrius,id=183036,bonus_id=6805,ilevel=220,enchant=16crit
finger2=ritualists_treasured_ring,id=183037,bonus_id=6805,ilevel=213,enchant=16crit
trinket1=dreadfire_vessel,id=184030,bonus_id=6805,ilevel=220,enchant=shadowcore_oil
trinket2=stone_legion_heraldry,id=184027,bonus_id=6805,ilevel=220
main_hand=deadeye_blunderbuss,id=184250,bonus_id=6805,ilevel=220,enchant=sinful_revelation

# Gear Summary
# gear_ilvl=217.27
# gear_agility=789
# gear_stamina=1300
# gear_crit_rating=443
# gear_haste_rating=604
# gear_mastery_rating=504
# gear_versatility_rating=54
# gear_armor=818

trapping_app : 10755 dps, 3718 dps to main target

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
10754.6 10754.6 19.8 / 0.184% 1334.7 / 12.4% 1060.0
RPS Out RPS In Primary Resource Waiting APM Active Skill
10.1 9.9 Focus 0.00% 47.4 100.0% 100%
Talents
Night Fae
Runeforge

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
trapping_app 10755
Aimed Shot 3686 (4052) 34.3% (37.7%) 47.6 6.27sec 25492 16485 Direct 237.5 (260.4) 3784 7578 4645 22.7% (22.7%)

Stats Details: Aimed Shot

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 47.56 237.55 0.00 0.00 1.5463 0.0000 1103450.30 1576168.41 29.99% 16485.38 16485.38
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 77.31% 183.65 125 244 3784.44 2524 9967 3786.42 3557 4051 694992 992726 29.99%
crit 22.69% 53.89 27 81 7577.70 5048 19934 7587.48 6361 9092 408458 583442 29.99%

Action Details: Aimed Shot

  • id:19434
  • school:physical
  • range:40.0
  • travel_speed:100.0000
  • radius:8.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:12.000
  • cooldown hasted:true
  • base_recharge_multiplier:1.000
  • base_execute_time:2.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:focus
  • base_cost:35.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:19434
  • name:Aimed Shot
  • school:physical
  • tooltip:
  • description:A powerful aimed shot that deals {$s1=0} Physical damage.

Action Priority List

    trickshots
    [J]:47.76
  • if_expr:buff.trick_shots.remains>=execute_time&(buff.precise_shots.down|full_recharge_time<cast_time+gcd|buff.trueshot.up)
  • target_if_expr:(dot.serpent_sting.remains<?action.serpent_sting.in_flight_to_target*dot.serpent_sting.duration)
    Aimed Shot (_double_tap) 366 3.4% 0.0 0.00sec 0 0 Direct 22.8 3893 7758 4776 22.9%

Stats Details: Aimed Shot Double Tap

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 0.00 22.81 0.00 0.00 0.0000 0.0000 108999.93 155695.51 29.99% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 77.10% 17.59 3 29 3892.74 2524 9967 3929.97 2796 6269 68470 97803 29.99%
crit 22.90% 5.22 0 13 7758.48 5048 19934 7756.27 0 18806 40530 57893 29.79%

Action Details: Aimed Shot Double Tap

  • id:19434
  • school:physical
  • range:40.0
  • travel_speed:100.0000
  • radius:8.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:12.000
  • cooldown hasted:true
  • base_recharge_multiplier:1.000
  • base_execute_time:2.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:focus
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:19434
  • name:Aimed Shot
  • school:physical
  • tooltip:
  • description:A powerful aimed shot that deals {$s1=0} Physical damage.
Auto Shot 374 3.5% 112.7 2.67sec 994 438 Direct 112.4 811 1623 996 22.8%

Stats Details: Auto Shot

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 112.67 112.41 0.00 0.00 2.2688 0.0000 111985.64 159960.29 29.99% 438.09 438.09
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 77.22% 86.81 63 115 811.38 774 1019 811.34 794 831 70435 100609 29.99%
crit 22.78% 25.60 12 46 1622.87 1548 2037 1622.83 1561 1697 41551 59351 29.99%

Action Details: Auto Shot

  • id:75
  • school:physical
  • range:40.0
  • travel_speed:60.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00

Spelldata

  • id:75
  • name:Auto Shot
  • school:physical
  • tooltip:Firing at the target.
  • description:Automatically shoots the target until cancelled.
Dreadfire Vessel 138 1.3% 3.7 90.74sec 11066 0 Direct 3.7 9048 18093 11093 22.6%

Stats Details: Dreadfire Vessel

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 3.73 3.72 0.00 0.00 0.0000 0.0000 41307.18 41307.18 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 77.38% 2.88 0 4 9048.16 8937 9474 9026.04 0 9474 26067 26067 0.00%
crit 22.62% 0.84 0 4 18093.48 17875 18947 11181.86 0 18947 15241 15241 0.00%

Action Details: Dreadfire Vessel

  • id:344732
  • school:fire
  • range:50.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:90.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:8212.26
  • base_dd_max:8212.26
  • base_dd_mult:1.00

Spelldata

  • id:344732
  • name:Dreadfire Vessel
  • school:fire
  • tooltip:
  • description:Unleash incendiary flames at your target inflicting {$s1=0} Fire damage.
Eternal Skirmish 40 0.4% 21.7 13.49sec 547 0 Direct 21.7 446 892 547 22.6%

Stats Details: Eternal Skirmish

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 21.73 21.73 0.00 0.00 0.0000 0.0000 11879.67 11879.67 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 77.43% 16.82 6 34 446.10 435 485 446.13 435 460 7504 7504 0.00%
crit 22.57% 4.90 0 13 892.07 871 969 889.33 0 969 4375 4375 0.00%

Action Details: Eternal Skirmish

  • id:323889
  • school:shadow
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:400.00
  • base_dd_max:400.00
  • base_dd_mult:1.00

Spelldata

  • id:323889
  • name:Eternal Skirmish
  • school:shadow
  • tooltip:
  • description:Deals {$s1=400} Shadow damage.
Kill Shot 83 0.8% 4.6 13.52sec 5434 4551 Direct 4.6 4260 9590 5477 22.9%

Stats Details: Kill Shot

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 4.61 4.57 0.00 0.00 1.1942 0.0000 25034.64 35759.48 29.99% 4550.92 4550.92
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 77.14% 3.53 0 7 4260.13 4065 4838 4250.65 0 4838 15018 21452 29.97%
crit 22.86% 1.04 0 4 9589.51 9146 10885 6609.56 0 10885 10017 14308 20.68%

Action Details: Kill Shot

  • id:53351
  • school:physical
  • range:40.0
  • travel_speed:80.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:10.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:focus
  • base_cost:10.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:53351
  • name:Kill Shot
  • school:physical
  • tooltip:
  • description:You attempt to finish off a wounded target, dealing {$s1=0} Physical damage. Only usable on enemies with less than {$s2=20}% health.

Action Priority List

    trickshots
    [M]:4.60
  • if_expr:buff.dead_eye.down
Master Marksman 485 4.5% 304.6 1.00sec 477 0 Periodic 520.8 279 0 279 0.0% 69.4%

Stats Details: Master Marksman

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 304.63 0.00 520.79 520.79 0.0000 2.0000 145263.34 145263.34 0.00% 139.46 0.00
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 100.00% 520.79 375 664 278.87 37 2627 279.18 231 340 145263 145263 0.00%

Action Details: Master Marksman

  • id:269576
  • school:physical
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:false
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:6.00
  • base_tick_time:2.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH

Spelldata

  • id:269576
  • name:Master Marksman
  • school:physical
  • tooltip:Bleeding for $w1 damage every $t1 sec.
  • description:{$@spelldesc260309=Your ranged special attack critical strikes cause the target to bleed for an additional {$s1=15}% of the damage dealt over {$269576d=6 seconds}.}
Multi-Shot 2694 25.1% 81.5 3.66sec 9911 8688 Direct 406.4 1619 3240 1987 22.7%

Stats Details: Multishot

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 81.47 406.42 0.00 0.00 1.1408 0.0000 807433.76 1153338.38 29.99% 8687.69 8687.69
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 77.29% 314.12 237 395 1618.50 953 2194 1618.44 1503 1710 508398 726196 29.99%
crit 22.71% 92.30 58 130 3239.62 1905 4389 3240.30 2951 3489 299035 427142 29.99%

Action Details: Multishot

  • id:257620
  • school:physical
  • range:40.0
  • travel_speed:50.0000
  • radius:10.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:5
  • harmful:true

Resources

  • resource:focus
  • base_cost:20.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:257620
  • name:Multi-Shot
  • school:physical
  • tooltip:
  • description:Fires several missiles, hitting your current target and up to $I enemies within $A1 yards for {$s1=0} Physical damage.

Action Priority List

    trickshots
    [L]:74.02
  • if_expr:buff.trick_shots.down|buff.precise_shots.up&focus>cost+action.aimed_shot.cost&(!talent.chimaera_shot|active_enemies>3)
    trickshots
    [N]:7.45
  • if_expr:focus>cost+action.aimed_shot.cost
Rapid Fire 1095 10.2% 16.4 18.46sec 20065 11424 Periodic 603.0 444 886 544 22.7% 1.6%

Stats Details: Rapid Fire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 16.35 0.00 120.95 603.00 1.7564 0.2035 328063.32 468605.64 29.99% 11424.41 11424.41
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 77.28% 466.02 308 654 443.53 351 925 443.59 429 458 206703 295255 29.99%
crit 22.72% 136.98 76 216 885.98 703 1850 886.06 813 982 121360 173351 29.99%

Action Details: Rapid Fire

  • id:257044
  • school:physical
  • range:40.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:20.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:false
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:2.00
  • base_tick_time:0.33
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH

Spelldata

  • id:257044
  • name:Rapid Fire
  • school:physical
  • tooltip:Being targeted by Rapid Fire.
  • description:Shoot a stream of {$s1=7} shots at your target over {$d=2 seconds}, dealing a total of ${$m1*$257045sw1} Physical damage. {$?s321281=true}[ Each shot generates {$263585s1=1} Focus.][] Usable while moving.

Action Details: Rapid Fire Damage

  • id:257045
  • school:physical
  • range:40.0
  • travel_speed:40.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:on_hit
  • energize_resource:focus
  • energize_amount:1.0

Spelldata

  • id:257045
  • name:Rapid Fire
  • school:physical
  • tooltip:
  • description:{$@spelldesc257044=Shoot a stream of {$s1=7} shots at your target over {$d=2 seconds}, dealing a total of ${$m1*$257045sw1} Physical damage. {$?s321281=true}[ Each shot generates {$263585s1=1} Focus.][] Usable while moving.}

Action Priority List

    trickshots
    [K]:16.35
  • if_expr:buff.trick_shots.remains>=execute_time
Shadowcore Oil Blast 44 0.4% 43.7 6.89sec 301 0 Direct 43.7 245 491 301 22.7%

Stats Details: Shadowcore Oil Blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 43.69 43.69 0.00 0.00 0.0000 0.0000 13153.85 13153.85 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 77.31% 33.78 18 56 245.39 239 266 245.40 242 251 8289 8289 0.00%
crit 22.69% 9.91 0 20 490.81 479 533 490.47 0 511 4865 4865 0.00%

Action Details: Shadowcore Oil Blast

  • id:336463
  • school:shadow
  • range:60.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:220.00
  • base_dd_max:220.00
  • base_dd_mult:1.00

Spelldata

  • id:336463
  • name:Shadowcore Oil Blast
  • school:shadow
  • tooltip:
  • description:Deals {$s1=220} Shadow damage.
Steady Shot 349 3.3% 66.6 4.48sec 1572 1167 Direct 67.5 1266 2531 1551 22.6%

Stats Details: Steady Shot

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 66.59 67.47 0.00 0.00 1.3476 0.0000 104692.58 149542.89 29.99% 1166.74 1166.74
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 77.43% 52.24 34 74 1265.93 1219 1605 1265.73 1236 1294 66141 94475 29.99%
crit 22.57% 15.23 6 28 2531.37 2439 3210 2531.00 2439 2687 38552 55067 29.99%

Action Details: Steady Shot

  • id:56641
  • school:physical
  • range:40.0
  • travel_speed:75.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:1.75
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:on_cast
  • energize_resource:focus
  • energize_amount:10.0

Spelldata

  • id:56641
  • name:Steady Shot
  • school:physical
  • tooltip:
  • description:A steady shot that causes {$s1=0} Physical damage. Usable while moving.{$?s321018=true}[ |cFFFFFFFFGenerates {$s2=0} Focus.][]

Action Priority List

    trickshots
    [F]:16.28
  • if_expr:talent.steady_focus&in_flight&buff.steady_focus.remains<5
    trickshots
    [O]:50.60
Wild Spirits 50 (1402) 0.5% (13.0%) 3.0 120.70sec 140208 127559 Direct 14.8 (233.3) 807 1615 994 23.1% (22.7%)

Stats Details: Wild Spirits

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.98 14.83 0.00 0.00 1.0992 0.0000 14740.81 14740.81 0.00% 127559.45 127559.45
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 76.90% 11.41 5 15 807.42 776 910 807.59 784 835 9210 9210 0.00%
crit 23.10% 3.43 0 10 1614.84 1552 1820 1583.27 0 1732 5531 5531 0.00%

Action Details: Wild Spirits

  • id:328231
  • school:nature
  • range:40.0
  • travel_speed:30.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:120.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:328231
  • name:Wild Spirits
  • school:nature
  • tooltip:
  • description:Evoke the energy of Wild Spirits at the target location, dealing {$328837s3=0} Nature damage and apply Hunter's Mark to all enemy targets within the area for {$328837d=15 seconds}. While the Wild Spirits are active, each damaging ability you or your pet use against a target in the area will strike up to $328757I nearby targets for {$328757s1=0} Nature damage.

Action Details: Wild Spirits Damage

  • id:328837
  • school:nature
  • range:100.0
  • travel_speed:0.0000
  • radius:12.0
  • trigger_gcd:0.0000
  • gcd_type:attack_haste
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:328837
  • name:Wild Spirits
  • school:nature
  • tooltip:
  • description:{$@spelldesc328231=Evoke the energy of Wild Spirits at the target location, dealing {$328837s3=0} Nature damage and apply Hunter's Mark to all enemy targets within the area for {$328837d=15 seconds}. While the Wild Spirits are active, each damaging ability you or your pet use against a target in the area will strike up to $328757I nearby targets for {$328757s1=0} Nature damage.}

Action Priority List

    trickshots
    [H]:2.98
    Wild Spirits (_proc) 1353 12.5% 43.7 5.90sec 9221 0 Direct 218.5 1504 3007 1844 22.6%

Stats Details: Wild Spirits Proc

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 43.69 218.47 0.00 0.00 0.0000 0.0000 402888.83 402888.83 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 77.35% 168.99 110 197 1503.68 1355 1699 1504.32 1485 1544 254114 254114 0.00%
crit 22.65% 49.48 23 76 3006.92 2711 3398 3008.19 2940 3121 148775 148775 0.00%

Action Details: Wild Spirits Proc

  • id:328757
  • school:nature
  • range:40.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:attack_haste
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:5
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:328757
  • name:Wild Spirits
  • school:nature
  • tooltip:
  • description:{$@spelldesc328231=Evoke the energy of Wild Spirits at the target location, dealing {$328837s3=0} Nature damage and apply Hunter's Mark to all enemy targets within the area for {$328837d=15 seconds}. While the Wild Spirits are active, each damaging ability you or your pet use against a target in the area will strike up to $328757I nearby targets for {$328757s1=0} Nature damage.}
Simple Action Stats Execute Interval
trapping_app
Veiled Augmentation (augmentation) 1.0 0.00sec

Stats Details: Augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Augmentation

  • id:347901
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:trapping_app
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Blood Fury 3.0 120.81sec

Stats Details: Blood Fury

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.97 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Blood Fury

  • id:20572
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:120.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:20572
  • name:Blood Fury
  • school:physical
  • tooltip:Attack power increased by $w1.
  • description:Increases your attack power by {$s1=122} for {$d=15 seconds}.

Action Priority List

    cds
    [D]:2.97
  • if_expr:buff.trueshot.up|target.time_to_die<16
Double Tap 5.6 60.62sec

Stats Details: Double Tap

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 5.60 0.00 0.00 0.00 0.9767 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Double Tap

  • id:260402
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:60.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:260402
  • name:Double Tap
  • school:physical
  • tooltip:Your next Aimed Shot will fire a second time instantly at {$s4=100}% power and consume no Focus, or your next Rapid Fire will shoot {$s3=100}% additional shots during its channel.
  • description:Your next Aimed Shot will fire a second time instantly at {$s4=100}% power without consuming Focus, or your next Rapid Fire will shoot {$s3=100}% additional shots during its channel.

Action Priority List

    trickshots
    [G]:4.60
  • if_expr:covenant.kyrian&cooldown.resonating_arrow.remains<gcd|cooldown.rapid_fire.remains<cooldown.aimed_shot.full_recharge_time|!(talent.streamline&runeforge.surging_shots)|!covenant.kyrian
Spectral Flask of Power (flask) 1.0 0.00sec

Stats Details: Flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Flask

  • id:307185
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:trapping_app
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Feast of Gluttonous Hedonism (food) 1.0 0.00sec

Stats Details: Food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Food

  • id:308462
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:trapping_app
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Potion of Spectral Agility (potion) 1.5 309.73sec

Stats Details: Potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.48 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Potion

  • id:307159
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:300.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Action Priority List

    cds
    [E]:1.47
  • if_expr:buff.trueshot.up&buff.bloodlust.up|buff.trueshot.up&target.health.pct<20|target.time_to_die<26
Trueshot 3.0 120.84sec

Stats Details: Trueshot

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.97 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Trueshot

  • id:288613
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:attack_haste
  • min_gcd:0.0000
  • cooldown:120.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:288613
  • name:Trueshot
  • school:physical
  • tooltip:The cooldown of Aimed Shot and Rapid Fire is reduced by ${$m1/4}%, and Aimed Shot casts {$s4=50}% faster. All Focus generation is increased by {$s5=50}%.
  • description:Reduces the cooldown of your Aimed Shot and Rapid Fire by ${$m1/4}%, and causes Aimed Shot to cast {$s4=50}% faster for {$d=15 seconds}. While Trueshot is active, you generate {$s5=50}% additional Focus.

Action Priority List

    trickshots
    [I]:2.97

Buffs

Dynamic Buffs Start Refresh Interval Trigger Avg Dur Up-Time Benefit Overflow Expiry
Blood Fury 3.0 0.0 120.8sec 120.8sec 14.7sec 14.63% 0.00% 0.0 (0.0) 2.8

Buff Details

  • buff initial source:trapping_app
  • cooldown name:buff_blood_fury
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:120.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:attack_power
  • amount:122.00

Trigger Details

  • interval_min/max:120.0s / 123.0s
  • trigger_min/max:120.0s / 123.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 15.0s

Stack Uptimes

  • blood_fury_1:14.63%

Spelldata

  • id:20572
  • name:Blood Fury
  • tooltip:Attack power increased by $w1.
  • description:Increases your attack power by {$s1=122} for {$d=15 seconds}.
  • max_stacks:0
  • duration:15.00
  • cooldown:120.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 40.0sec 13.52% 0.00% 0.0 (0.0) 1.0

Buff Details

  • buff initial source:trapping_app
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • base duration:40.00
  • duration modifier:1.00
  • base cooldown:300.00
  • default_chance:100.00%
  • default_value:0.30
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:40.0s / 40.0s

Stack Uptimes

  • bloodlust_1:13.52%

Spelldata

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by $w1%.
  • description:Increases haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Double Tap 5.6 0.0 58.4sec 60.6sec 4.5sec 8.36% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:trapping_app
  • cooldown name:buff_double_tap
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.50
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:50.0s / 62.6s
  • trigger_min/max:60.0s / 62.6s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 11.2s

Stack Uptimes

  • double_tap_1:8.36%

Spelldata

  • id:260402
  • name:Double Tap
  • tooltip:Your next Aimed Shot will fire a second time instantly at {$s4=100}% power and consume no Focus, or your next Rapid Fire will shoot {$s3=100}% additional shots during its channel.
  • description:Your next Aimed Shot will fire a second time instantly at {$s4=100}% power without consuming Focus, or your next Rapid Fire will shoot {$s3=100}% additional shots during its channel.
  • max_stacks:0
  • duration:15.00
  • cooldown:60.00
  • default_chance:0.00%
Well Fed (feast_of_gluttonous_hedonism) 1.0 0.0 0.0sec 0.0sec 300.0sec 100.00% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:trapping_app
  • cooldown name:buff_feast_of_gluttonous_hedonism
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:agility
  • amount:20.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:240.1s / 359.8s

Stack Uptimes

  • feast_of_gluttonous_hedonism_1:100.00%

Spelldata

  • id:327709
  • name:Well Fed
  • tooltip:Agility increased by $w1.
  • description:Agility increased by {$s1=20}. Lasts {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Lock and Load 8.7 0.2 30.6sec 29.8sec 1.8sec 5.34% 17.95% 0.2 (0.2) 0.0

Buff Details

  • buff initial source:trapping_app
  • cooldown name:buff_lock_and_load
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:8.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:1.8s / 254.3s
  • trigger_min/max:1.8s / 254.3s
  • trigger_pct:7.95%
  • duration_min/max:0.0s / 11.1s

Stack Uptimes

  • lock_and_load_1:5.34%

Spelldata

  • id:194594
  • name:Lock and Load
  • tooltip:Aimed Shot costs no Focus and is instant.
  • description:{$@spelldesc194595=Your ranged auto attacks have a {$194595h=8}% chance to trigger Lock and Load, causing your next Aimed Shot to cost no Focus and be instant.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%

Trigger Spelldata

  • id:194595
  • name:Lock and Load
  • tooltip:
  • description:Your ranged auto attacks have a {$194595h=8}% chance to trigger Lock and Load, causing your next Aimed Shot to cost no Focus and be instant.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:8.00%
Potion of Spectral Agility 1.5 0.0 309.2sec 309.2sec 23.3sec 11.25% 0.00% 0.0 (0.0) 1.2

Buff Details

  • buff initial source:trapping_app
  • cooldown name:buff_potion_of_spectral_agility
  • max_stacks:1
  • base duration:25.00
  • duration modifier:1.00
  • base cooldown:1.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:agility
  • amount:190.00

Trigger Details

  • interval_min/max:300.0s / 332.8s
  • trigger_min/max:300.0s / 332.8s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 25.0s

Stack Uptimes

  • potion_of_spectral_agility_1:11.25%

Spelldata

  • id:307159
  • name:Potion of Spectral Agility
  • tooltip:Agility increased by $w1.
  • description:Increases your Agility by {$s1=190} for {$d=25 seconds}.
  • max_stacks:0
  • duration:25.00
  • cooldown:1.00
  • default_chance:0.00%
Precise Shots 40.0 7.5 7.5sec 6.3sec 2.9sec 38.70% 82.38% 3.7 (3.7) 0.0

Buff Details

  • buff initial source:trapping_app
  • cooldown name:buff_precise_shots
  • max_stacks:2
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.50
  • default_chance:101.00%
  • default_value:0.75
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.9s / 35.7s
  • trigger_min/max:0.9s / 14.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 32.5s

Stack Uptimes

  • precise_shots_1:33.30%
  • precise_shots_2:5.40%

Spelldata

  • id:260242
  • name:Precise Shots
  • tooltip:Damage of {$?s342049=false}[Chimaera Shot][Arcane Shot] or Multi-Shot increased by {$s1=75}%.
  • description:{$@spelldesc260240=Aimed Shot causes your next 1-{$260242u=2} {$?s342049=false}[Chimaera Shots][Arcane Shots] or Multi-Shots to deal {$260242s1=75}% more damage.}
  • max_stacks:2
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
Spectral Flask of Power 1.0 0.0 0.0sec 0.0sec 300.0sec 100.00% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:trapping_app
  • cooldown name:buff_spectral_flask_of_power
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:agility
  • amount:70.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:240.1s / 359.8s

Stack Uptimes

  • spectral_flask_of_power_1:100.00%

Spelldata

  • id:307185
  • name:Spectral Flask of Power
  • tooltip:$pri increased by $w1.
  • description:Increases $pri by {$s1=70} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Steady Focus 6.2 18.6 51.0sec 12.2sec 45.4sec 94.32% 0.00% 18.6 (18.6) 5.3

Buff Details

  • buff initial source:trapping_app
  • cooldown name:buff_steady_focus
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.07
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:15.0s / 298.6s
  • trigger_min/max:4.0s / 43.1s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 297.2s

Stack Uptimes

  • steady_focus_1:94.32%

Spelldata

  • id:193534
  • name:Steady Focus
  • tooltip:Haste increased by {$s1=7}%.
  • description:{$@spelldesc193533=Using Steady Shot twice in a row increases your Haste by {$193534s1=7}% for {$193534d=15 seconds}.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%

Trigger Spelldata

  • id:193533
  • name:Steady Focus
  • tooltip:
  • description:Using Steady Shot twice in a row increases your Haste by {$193534s1=7}% for {$193534d=15 seconds}.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
Trick Shots 64.7 16.8 4.6sec 3.7sec 4.1sec 88.79% 100.00% 16.8 (16.8) 0.0

Buff Details

  • buff initial source:trapping_app
  • cooldown name:buff_trick_shots
  • max_stacks:1
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:1.8s / 12.3s
  • trigger_min/max:0.9s / 10.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 12.3s

Stack Uptimes

  • trick_shots_1:88.79%

Spelldata

  • id:257622
  • name:Trick Shots
  • tooltip:Your next Aimed Shot or Rapid Fire will ricochet and hit {$257621s1=5} additional targets for {$257621s4=50}% of normal damage.
  • description:{$@spelldesc257621=When Multi-Shot hits {$s2=3} or more targets, your next Aimed Shot or Rapid Fire will ricochet and hit up to {$s1=5} additional targets for {$s4=50}% of normal damage.}
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
Trueshot 3.0 0.0 120.8sec 120.8sec 19.1sec 18.98% 0.00% 0.0 (0.0) 2.8

Buff Details

  • buff initial source:trapping_app
  • cooldown name:buff_trueshot
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.31
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.50
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:120.0s / 123.0s
  • trigger_min/max:120.0s / 123.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 19.7s

Stack Uptimes

  • trueshot_1:18.98%

Spelldata

  • id:288613
  • name:Trueshot
  • tooltip:The cooldown of Aimed Shot and Rapid Fire is reduced by ${$m1/4}%, and Aimed Shot casts {$s4=50}% faster. All Focus generation is increased by {$s5=50}%.
  • description:Reduces the cooldown of your Aimed Shot and Rapid Fire by ${$m1/4}%, and causes Aimed Shot to cast {$s4=50}% faster for {$d=15 seconds}. While Trueshot is active, you generate {$s5=50}% additional Focus.
  • max_stacks:0
  • duration:15.00
  • cooldown:120.00
  • default_chance:0.00%
Veiled Augmentation 1.0 0.0 0.0sec 0.0sec 300.0sec 100.00% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:trapping_app
  • cooldown name:buff_veiled_augmentation
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:agility
  • amount:18.00
  • stat:strength
  • amount:18.00
  • stat:intellect
  • amount:18.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:240.1s / 359.8s

Stack Uptimes

  • veiled_augmentation_1:100.00%

Spelldata

  • id:347901
  • name:Veiled Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=18} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Wild Spirits 3.0 0.0 120.7sec 120.7sec 17.5sec 17.43% 0.00% 0.0 (0.0) 2.8

Buff Details

  • buff initial source:trapping_app
  • cooldown name:buff_wild_spirits
  • max_stacks:1
  • base duration:18.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:120.0s / 122.7s
  • trigger_min/max:120.0s / 122.7s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 18.0s

Stack Uptimes

  • wild_spirits_1:17.43%

Spelldata

  • id:328837
  • name:Wild Spirits
  • tooltip:
  • description:{$@spelldesc328231=Evoke the energy of Wild Spirits at the target location, dealing {$328837s3=0} Nature damage and apply Hunter's Mark to all enemy targets within the area for {$328837d=15 seconds}. While the Wild Spirits are active, each damaging ability you or your pet use against a target in the area will strike up to $328757I nearby targets for {$328757s1=0} Nature damage.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
Windfury Totem 1.0 0.0 0.0sec 0.0sec 300.0sec 100.00% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:trapping_app
  • cooldown name:buff_windfury_totem
  • max_stacks:1
  • base duration:900.00
  • duration modifier:1.00
  • base cooldown:0.50
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:240.1s / 359.8s

Stack Uptimes

  • windfury_totem_1:100.00%

Spelldata

  • id:327942
  • name:Windfury Totem
  • tooltip:Your auto-attacks have a {$h=10}% chance to instantly attack again.
  • description:{$@spelldesc8512=Summons a Windfury Totem with {$s1=5} health at the feet of the caster for {$d=120 seconds}. Party members within {$s2=30} yds have a {$327942h=10}% chance when they auto-attack to swing an extra time.}
  • max_stacks:0
  • duration:120.00
  • cooldown:0.00
  • default_chance:10.00%
Constant Buffs
Arcane Intellect

Buff Details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff Details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:15.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
Power Word: Fortitude

Buff Details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.$?$w2>0[ Magic damage taken reduced by $w2%.][]
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Procs, Uptimes & Benefits

Proc Count Min Max Interval Min Max
double_tap_aimed 4.6 1.0 7.0 69.5s 47.1s 300.2s
double_tap_rapid_fire 1.0 0.0 5.0 96.5s 54.9s 245.1s
Uptime Avg % Min Max Avg Dur Min Max
Focus Cap 0.87% 0.68% 1.57% 0.9s 0.0s 2.4s

Cooldown waste details

Seconds per ExecuteSeconds per Iteration
AbilityAverageMinimumMaximumAverageMinimumMaximum
Double Tap0.7360.0012.6602.7430.0007.344
Aimed Shot1.2680.0016.80813.2853.23725.018
Kill Shot3.7570.00119.91312.4710.13230.419
Wild Spirits0.7850.0012.7021.3500.0004.798
Trueshot0.8620.0012.9761.6190.2715.069
Rapid Fire3.1410.00125.80442.16515.26874.437

Resources

Gains Type Count Total Tot% Avg Overflow Ovr%
trapping_app
steady_shot Focus 67.58 655.81 22.05% 9.70 20.03 2.96%
rapid_fire Focus 120.98 120.79 4.06% 1.00 0.18 0.15%
focus_regen Focus 609.55 1945.27 65.41% 3.19 19.16 0.98%
Trueshot Focus 191.14 252.00 8.47% 1.32 0.87 0.34%
Change Start Gain/s Loss/s Overflow (Total) End (Avg) Min Max
Focus 100.0 9.91 10.12 40.2 37.0 0.1 97.7
Usage Type Count Total Avg RPE APR
trapping_app
aimed_shot Focus 47.6 1361.5 28.6 28.6 890.5
kill_shot Focus 4.6 46.0 10.0 10.0 544.6
multishot Focus 81.5 1629.4 20.0 20.0 495.5

Statistics & Data Analysis

Fight Length
trapping_app Fight Length
Count 1217
Mean 299.97
Minimum 240.10
Maximum 359.83
Spread ( max - min ) 119.74
Range [ ( max - min ) / 2 * 100% ] 19.96%
DPS
trapping_app Damage Per Second
Count 1217
Mean 10754.59
Minimum 9683.63
Maximum 11905.52
Spread ( max - min ) 2221.89
Range [ ( max - min ) / 2 * 100% ] 10.33%
Standard Deviation 351.6222
5th Percentile 10199.96
95th Percentile 11330.45
( 95th Percentile - 5th Percentile ) 1130.50
Mean Distribution
Standard Deviation 10.0793
95.00% Confidence Interval ( 10734.84 - 10774.35 )
Normalized 95.00% Confidence Interval ( 99.82% - 100.18% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 42
0.1% Error 4107
0.1 Scale Factor Error with Delta=300 1056
0.05 Scale Factor Error with Delta=300 4222
0.01 Scale Factor Error with Delta=300 105545
Priority Target DPS
trapping_app Priority Target Damage Per Second
Count 1217
Mean 3717.60
Minimum 3281.87
Maximum 4154.98
Spread ( max - min ) 873.11
Range [ ( max - min ) / 2 * 100% ] 11.74%
Standard Deviation 135.9734
5th Percentile 3511.81
95th Percentile 3952.67
( 95th Percentile - 5th Percentile ) 440.86
Mean Distribution
Standard Deviation 3.8977
95.00% Confidence Interval ( 3709.96 - 3725.24 )
Normalized 95.00% Confidence Interval ( 99.79% - 100.21% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 52
0.1% Error 5140
0.1 Scale Factor Error with Delta=300 158
0.05 Scale Factor Error with Delta=300 632
0.01 Scale Factor Error with Delta=300 15784
DPS(e)
trapping_app Damage Per Second (Effective)
Count 1217
Mean 10754.59
Minimum 9683.63
Maximum 11905.52
Spread ( max - min ) 2221.89
Range [ ( max - min ) / 2 * 100% ] 10.33%
Damage
trapping_app Damage
Count 1217
Mean 3218893.87
Minimum 2449776.43
Maximum 3904566.89
Spread ( max - min ) 1454790.47
Range [ ( max - min ) / 2 * 100% ] 22.60%
DTPS
trapping_app Damage Taken Per Second
Count 1217
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
trapping_app Healing Per Second
Count 1217
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
trapping_app Healing Per Second (Effective)
Count 1217
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
trapping_app Heal
Count 1217
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
trapping_app Healing Taken Per Second
Count 1217
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
trapping_app Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
trapping_appTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
trapping_app Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask
1 0.00 augmentation
2 0.00 food
3 0.00 snapshot_stats
Snapshot raid buffed stats before combat begins and pre-potting is done.
4 0.00 tar_trap,if=runeforge.soulforge_embers
5 0.00 double_tap,precast_time=10,if=!covenant.kyrian&(!talent.volley|active_enemies<2)
6 0.00 aimed_shot,if=active_enemies<3
7 0.00 steady_shot,if=active_enemies>2
Default action list Executed every time the actor is available.
# count action,conditions
8 1.00 auto_shot
0.00 counter_shot,line_cd=30,if=runeforge.sephuzs_proclamation|soulbind.niyas_tools_poison|(conduit.reversal_of_fortune&!runeforge.sephuzs_proclamation)
9 3.74 use_items
A 0.00 call_action_list,name=cds
B 0.00 call_action_list,name=st,if=active_enemies<3
C 0.00 call_action_list,name=trickshots,if=active_enemies>2
actions.cds
# count action,conditions
0.00 berserking,if=buff.trueshot.up|target.time_to_die<13
D 2.97 blood_fury,if=buff.trueshot.up|target.time_to_die<16
0.00 ancestral_call,if=buff.trueshot.up|target.time_to_die<16
0.00 fireblood,if=buff.trueshot.up|target.time_to_die<9
0.00 lights_judgment,if=buff.trueshot.down
0.00 bag_of_tricks,if=buff.trueshot.down
E 1.47 potion,if=buff.trueshot.up&buff.bloodlust.up|buff.trueshot.up&target.health.pct<20|target.time_to_die<26
actions.trickshots
# count action,conditions
F 16.28 steady_shot,if=talent.steady_focus&in_flight&buff.steady_focus.remains<5
G 4.60 double_tap,if=covenant.kyrian&cooldown.resonating_arrow.remains<gcd|cooldown.rapid_fire.remains<cooldown.aimed_shot.full_recharge_time|!(talent.streamline&runeforge.surging_shots)|!covenant.kyrian
0.00 tar_trap,if=runeforge.soulforge_embers&tar_trap.remains<gcd&cooldown.flare.remains<gcd
0.00 flare,if=tar_trap.up&runeforge.soulforge_embers
0.00 explosive_shot
H 2.98 wild_spirits
0.00 resonating_arrow
0.00 volley
0.00 barrage
I 2.97 trueshot
0.00 rapid_fire,if=buff.trick_shots.remains>=execute_time&runeforge.surging_shots&buff.double_tap.down
J 47.76 aimed_shot,target_if=min:(dot.serpent_sting.remains<?action.serpent_sting.in_flight_to_target*dot.serpent_sting.duration),if=buff.trick_shots.remains>=execute_time&(buff.precise_shots.down|full_recharge_time<cast_time+gcd|buff.trueshot.up)
0.00 death_chakram,if=focus+cast_regen<focus.max
K 16.35 rapid_fire,if=buff.trick_shots.remains>=execute_time
L 74.02 multishot,if=buff.trick_shots.down|buff.precise_shots.up&focus>cost+action.aimed_shot.cost&(!talent.chimaera_shot|active_enemies>3)
0.00 chimaera_shot,if=buff.precise_shots.up&focus>cost+action.aimed_shot.cost&active_enemies<4
M 4.60 kill_shot,if=buff.dead_eye.down
0.00 a_murder_of_crows
0.00 flayed_shot
0.00 serpent_sting,target_if=min:dot.serpent_sting.remains,if=refreshable
N 7.45 multishot,if=focus>cost+action.aimed_shot.cost
O 50.60 steady_shot

Sample Sequence

0125789FHIDELJLJLKLJLOFJLJOLKLJLOOJLLJOLKLOJLOFLJLOOJLOOGKLJLONNOFJLOLNKLJLOFLJLOOJLL9JLKLOFJLOONOJLGOKLNJLLHIDJLOFJLJLJLKLJOFLJLKLJLOFLJLOOOLJLKLGJOFLOL9OJLOOKLJLJLLJLOFJLOOKLJLOOLNOJLJLLJOFGLJLKLOHIDJLOFJLJOLKLJLOFJLKLJO9LOFLJLOOJLKLJLMGOFJLOOMJLKLOOMJLOONNOJLEKLMOFJLJLJLJLMOFJLK

Sample Sequence Table

Time List # Name Target Resources Buffs
Pre precombat 0 flask trapping_app 100.0/100: 100% focus
Pre precombat 1 augmentation trapping_app 100.0/100: 100% focus
Pre precombat 2 food trapping_app 100.0/100: 100% focus
Pre precombat 5 double_tap Fluffy_Pillow 100.0/100: 100% focus
Pre precombat 7 steady_shot Fluffy_Pillow 100.0/100: 100% focus double_tap
0:00.000 default 8 auto_attack Fluffy_Pillow 100.0/100: 100% focus double_tap
0:00.000 default 9 use_items Fluffy_Pillow 100.0/100: 100% focus double_tap
0:00.000 trickshots F steady_shot Fluffy_Pillow 100.0/100: 100% focus double_tap
0:01.484 trickshots H wild_spirits Fluffy_Pillow 100.0/100: 100% focus bloodlust, double_tap, steady_focus
0:02.401 trickshots I trueshot Fluffy_Pillow 100.0/100: 100% focus bloodlust, double_tap, steady_focus
0:02.401 cds D blood_fury Fluffy_Pillow 100.0/100: 100% focus bloodlust, double_tap, steady_focus, trueshot
0:02.401 cds E potion Fluffy_Pillow 100.0/100: 100% focus bloodlust, blood_fury, double_tap, steady_focus, trueshot
0:02.401 trickshots L multishot Fluffy_Pillow 100.0/100: 100% focus bloodlust, blood_fury, double_tap, steady_focus, trueshot, potion_of_spectral_agility
0:03.318 trickshots J aimed_shot Fluffy_Pillow 91.3/100: 91% focus bloodlust, blood_fury, double_tap, steady_focus, trick_shots, trueshot, wild_spirits, potion_of_spectral_agility
0:04.232 trickshots L multishot Fluffy_Pillow 66.9/100: 67% focus bloodlust, blood_fury, precise_shots(2), steady_focus, trueshot, wild_spirits, potion_of_spectral_agility
0:05.148 trickshots J aimed_shot Fluffy_Pillow 58.2/100: 58% focus bloodlust, blood_fury, precise_shots, steady_focus, trick_shots, trueshot, wild_spirits, potion_of_spectral_agility
0:06.066 trickshots L multishot Fluffy_Pillow 34.5/100: 35% focus bloodlust, blood_fury, precise_shots(2), steady_focus, trueshot, wild_spirits, potion_of_spectral_agility
0:06.981 trickshots K rapid_fire Fluffy_Pillow 25.8/100: 26% focus bloodlust, blood_fury, precise_shots, steady_focus, trick_shots, trueshot, wild_spirits, potion_of_spectral_agility
0:08.514 trickshots L multishot Fluffy_Pillow 55.8/100: 56% focus bloodlust, blood_fury, precise_shots, steady_focus, trueshot, wild_spirits, potion_of_spectral_agility
0:09.431 trickshots J aimed_shot Fluffy_Pillow 47.1/100: 47% focus bloodlust, blood_fury, steady_focus, trick_shots, trueshot, wild_spirits, potion_of_spectral_agility
0:10.345 trickshots L multishot Fluffy_Pillow 23.4/100: 23% focus bloodlust, blood_fury, precise_shots, steady_focus, trueshot, wild_spirits, potion_of_spectral_agility
0:11.259 trickshots O steady_shot Fluffy_Pillow 14.6/100: 15% focus bloodlust, blood_fury, steady_focus, trick_shots, trueshot, wild_spirits, potion_of_spectral_agility
0:12.325 trickshots F steady_shot Fluffy_Pillow 42.8/100: 43% focus bloodlust, blood_fury, steady_focus, trick_shots, trueshot, wild_spirits, potion_of_spectral_agility
0:13.392 trickshots J aimed_shot Fluffy_Pillow 71.0/100: 71% focus bloodlust, blood_fury, steady_focus, trick_shots, trueshot, wild_spirits, potion_of_spectral_agility
0:14.308 trickshots L multishot Fluffy_Pillow 47.3/100: 47% focus bloodlust, blood_fury, precise_shots(2), steady_focus, trueshot, wild_spirits, potion_of_spectral_agility
0:15.224 trickshots J aimed_shot Fluffy_Pillow 38.6/100: 39% focus bloodlust, blood_fury, precise_shots, steady_focus, trick_shots, trueshot, wild_spirits, potion_of_spectral_agility
0:16.139 trickshots O steady_shot Fluffy_Pillow 14.9/100: 15% focus bloodlust, blood_fury, precise_shots(2), steady_focus, trueshot, wild_spirits, potion_of_spectral_agility
0:17.208 trickshots L multishot Fluffy_Pillow 43.1/100: 43% focus bloodlust, blood_fury, precise_shots(2), steady_focus, trueshot, wild_spirits, potion_of_spectral_agility
0:18.125 trickshots K rapid_fire Fluffy_Pillow 34.4/100: 34% focus bloodlust, precise_shots, steady_focus, trick_shots, trueshot, wild_spirits, potion_of_spectral_agility
0:19.494 trickshots L multishot Fluffy_Pillow 61.3/100: 61% focus bloodlust, precise_shots, steady_focus, trueshot, wild_spirits, potion_of_spectral_agility
0:20.409 trickshots J aimed_shot Fluffy_Pillow 52.6/100: 53% focus bloodlust, steady_focus, trick_shots, trueshot, wild_spirits, potion_of_spectral_agility
0:21.324 trickshots L multishot Fluffy_Pillow 28.9/100: 29% focus bloodlust, precise_shots(2), steady_focus, trueshot, potion_of_spectral_agility
0:22.240 trickshots O steady_shot Fluffy_Pillow 19.4/100: 19% focus bloodlust, precise_shots, steady_focus, trick_shots, potion_of_spectral_agility
0:23.307 trickshots O steady_shot Fluffy_Pillow 38.2/100: 38% focus bloodlust, precise_shots, steady_focus, trick_shots, potion_of_spectral_agility
0:24.375 trickshots J aimed_shot Fluffy_Pillow 57.0/100: 57% focus bloodlust, precise_shots, steady_focus, trick_shots, potion_of_spectral_agility
0:25.898 trickshots L multishot Fluffy_Pillow 34.5/100: 34% focus bloodlust, lock_and_load, precise_shots(2), steady_focus, potion_of_spectral_agility
0:26.813 trickshots L multishot Fluffy_Pillow 22.0/100: 22% focus bloodlust, lock_and_load, precise_shots, steady_focus, trick_shots, potion_of_spectral_agility
0:27.730 trickshots J aimed_shot Fluffy_Pillow 9.6/100: 10% focus bloodlust, lock_and_load, steady_focus, trick_shots
0:28.644 trickshots O steady_shot Fluffy_Pillow 17.1/100: 17% focus bloodlust, precise_shots(2), steady_focus
0:29.713 trickshots L multishot Fluffy_Pillow 35.9/100: 36% focus bloodlust, precise_shots(2), steady_focus
0:30.629 trickshots K rapid_fire Fluffy_Pillow 23.4/100: 23% focus bloodlust, precise_shots, steady_focus, trick_shots
0:32.140 trickshots L multishot Fluffy_Pillow 42.8/100: 43% focus bloodlust, precise_shots, steady_focus
0:33.055 trickshots O steady_shot Fluffy_Pillow 30.4/100: 30% focus bloodlust, steady_focus, trick_shots
0:34.124 trickshots J aimed_shot Fluffy_Pillow 49.2/100: 49% focus bloodlust, steady_focus, trick_shots
0:35.649 trickshots L multishot Fluffy_Pillow 26.7/100: 27% focus bloodlust, lock_and_load, precise_shots(2), steady_focus
0:36.565 trickshots O steady_shot Fluffy_Pillow 14.3/100: 14% focus bloodlust, lock_and_load, precise_shots, steady_focus, trick_shots
0:37.634 trickshots F steady_shot Fluffy_Pillow 33.1/100: 33% focus bloodlust, lock_and_load, precise_shots, steady_focus, trick_shots
0:38.704 trickshots L multishot Fluffy_Pillow 51.9/100: 52% focus bloodlust, lock_and_load, precise_shots, steady_focus, trick_shots
0:39.618 trickshots J aimed_shot Fluffy_Pillow 39.4/100: 39% focus bloodlust, lock_and_load, steady_focus, trick_shots
0:40.534 trickshots L multishot Fluffy_Pillow 46.9/100: 47% focus bloodlust, precise_shots, steady_focus
0:41.451 trickshots O steady_shot Fluffy_Pillow 33.6/100: 34% focus steady_focus, trick_shots
0:42.837 trickshots O steady_shot Fluffy_Pillow 52.4/100: 52% focus steady_focus, trick_shots
0:44.222 trickshots J aimed_shot Fluffy_Pillow 71.1/100: 71% focus steady_focus, trick_shots
0:46.201 trickshots L multishot Fluffy_Pillow 48.7/100: 49% focus precise_shots(2), steady_focus
0:47.389 trickshots O steady_shot Fluffy_Pillow 36.2/100: 36% focus precise_shots, steady_focus, trick_shots
0:48.776 trickshots O steady_shot Fluffy_Pillow 55.0/100: 55% focus precise_shots, steady_focus, trick_shots
0:50.164 trickshots G double_tap Fluffy_Pillow 73.7/100: 74% focus precise_shots, steady_focus, trick_shots
0:51.352 trickshots K rapid_fire Fluffy_Pillow 81.3/100: 81% focus double_tap, precise_shots, steady_focus, trick_shots
0:53.305 trickshots L multishot Fluffy_Pillow 100.0/100: 100% focus precise_shots, steady_focus
0:54.495 trickshots J aimed_shot Fluffy_Pillow 87.5/100: 88% focus steady_focus, trick_shots
0:56.472 trickshots L multishot Fluffy_Pillow 65.0/100: 65% focus precise_shots, steady_focus
0:57.660 trickshots O steady_shot Fluffy_Pillow 52.5/100: 53% focus steady_focus, trick_shots
0:59.046 trickshots N multishot Fluffy_Pillow 71.3/100: 71% focus steady_focus, trick_shots
1:00.235 trickshots N multishot Fluffy_Pillow 58.8/100: 59% focus steady_focus, trick_shots
1:01.424 trickshots O steady_shot Fluffy_Pillow 46.4/100: 46% focus steady_focus, trick_shots
1:02.809 trickshots F steady_shot Fluffy_Pillow 65.1/100: 65% focus steady_focus, trick_shots
1:04.197 trickshots J aimed_shot Fluffy_Pillow 83.9/100: 84% focus steady_focus, trick_shots
1:06.175 trickshots L multishot Fluffy_Pillow 61.4/100: 61% focus precise_shots(2), steady_focus
1:07.365 trickshots O steady_shot Fluffy_Pillow 49.0/100: 49% focus precise_shots, steady_focus, trick_shots
1:08.752 trickshots L multishot Fluffy_Pillow 67.7/100: 68% focus precise_shots, steady_focus, trick_shots
1:09.939 trickshots N multishot Fluffy_Pillow 55.3/100: 55% focus steady_focus, trick_shots
1:11.126 trickshots K rapid_fire Fluffy_Pillow 42.8/100: 43% focus steady_focus, trick_shots
1:13.184 trickshots L multishot Fluffy_Pillow 62.8/100: 63% focus steady_focus
1:14.372 trickshots J aimed_shot Fluffy_Pillow 50.3/100: 50% focus steady_focus, trick_shots
1:16.351 trickshots L multishot Fluffy_Pillow 27.8/100: 28% focus lock_and_load, precise_shots(2), steady_focus
1:17.539 trickshots O steady_shot Fluffy_Pillow 15.4/100: 15% focus lock_and_load, precise_shots, steady_focus, trick_shots
1:18.925 trickshots F steady_shot Fluffy_Pillow 34.1/100: 34% focus lock_and_load, precise_shots, steady_focus, trick_shots
1:20.313 trickshots L multishot Fluffy_Pillow 52.5/100: 52% focus lock_and_load, precise_shots, steady_focus, trick_shots
1:21.502 trickshots J aimed_shot Fluffy_Pillow 40.0/100: 40% focus lock_and_load, steady_focus, trick_shots
1:22.693 trickshots L multishot Fluffy_Pillow 47.5/100: 48% focus precise_shots, steady_focus
1:23.880 trickshots O steady_shot Fluffy_Pillow 35.0/100: 35% focus steady_focus, trick_shots
1:25.266 trickshots O steady_shot Fluffy_Pillow 53.8/100: 54% focus steady_focus, trick_shots
1:26.651 trickshots J aimed_shot Fluffy_Pillow 72.6/100: 73% focus steady_focus, trick_shots
1:28.628 trickshots L multishot Fluffy_Pillow 50.1/100: 50% focus lock_and_load, precise_shots(2), steady_focus
1:29.816 trickshots L multishot Fluffy_Pillow 37.6/100: 38% focus lock_and_load, precise_shots, steady_focus, trick_shots
1:31.005 default 9 use_items Fluffy_Pillow 25.1/100: 25% focus lock_and_load, steady_focus, trick_shots
1:31.005 trickshots J aimed_shot Fluffy_Pillow 25.1/100: 25% focus lock_and_load, steady_focus, trick_shots
1:32.194 trickshots L multishot Fluffy_Pillow 32.6/100: 33% focus precise_shots, steady_focus
1:33.383 trickshots K rapid_fire Fluffy_Pillow 20.2/100: 20% focus steady_focus, trick_shots
1:35.216 trickshots L multishot Fluffy_Pillow 38.8/100: 39% focus steady_focus
1:36.404 trickshots O steady_shot Fluffy_Pillow 26.3/100: 26% focus steady_focus, trick_shots
1:37.792 trickshots F steady_shot Fluffy_Pillow 45.1/100: 45% focus steady_focus, trick_shots
1:39.179 trickshots J aimed_shot Fluffy_Pillow 63.9/100: 64% focus steady_focus, trick_shots
1:41.158 trickshots L multishot Fluffy_Pillow 41.4/100: 41% focus precise_shots, steady_focus
1:42.348 trickshots O steady_shot Fluffy_Pillow 28.9/100: 29% focus steady_focus, trick_shots
1:43.736 trickshots O steady_shot Fluffy_Pillow 47.7/100: 48% focus steady_focus, trick_shots
1:45.121 trickshots N multishot Fluffy_Pillow 66.5/100: 66% focus steady_focus, trick_shots
1:46.311 trickshots O steady_shot Fluffy_Pillow 54.0/100: 54% focus steady_focus, trick_shots
1:47.698 trickshots J aimed_shot Fluffy_Pillow 72.8/100: 73% focus steady_focus, trick_shots
1:49.678 trickshots L multishot Fluffy_Pillow 50.3/100: 50% focus precise_shots(2), steady_focus
1:50.866 trickshots G double_tap Fluffy_Pillow 37.8/100: 38% focus precise_shots, steady_focus, trick_shots
1:52.055 trickshots O steady_shot Fluffy_Pillow 45.4/100: 45% focus double_tap, precise_shots, steady_focus, trick_shots
1:53.442 trickshots K rapid_fire Fluffy_Pillow 64.1/100: 64% focus double_tap, precise_shots, steady_focus, trick_shots
1:55.379 trickshots L multishot Fluffy_Pillow 90.4/100: 90% focus precise_shots, steady_focus
1:56.567 trickshots N multishot Fluffy_Pillow 77.9/100: 78% focus steady_focus, trick_shots
1:57.756 trickshots J aimed_shot Fluffy_Pillow 65.4/100: 65% focus steady_focus, trick_shots
1:59.737 trickshots L multishot Fluffy_Pillow 43.0/100: 43% focus precise_shots(2), steady_focus
2:00.925 trickshots L multishot Fluffy_Pillow 30.2/100: 30% focus lock_and_load, precise_shots, trick_shots
2:02.197 trickshots H wild_spirits Fluffy_Pillow 17.7/100: 18% focus lock_and_load, trick_shots
2:03.470 trickshots I trueshot Fluffy_Pillow 25.2/100: 25% focus lock_and_load, trick_shots
2:03.470 cds D blood_fury Fluffy_Pillow 25.2/100: 25% focus lock_and_load, trick_shots, trueshot
2:03.470 trickshots J aimed_shot Fluffy_Pillow 25.2/100: 25% focus blood_fury, lock_and_load, trick_shots, trueshot
2:04.742 trickshots L multishot Fluffy_Pillow 36.5/100: 36% focus blood_fury, precise_shots(2), trueshot, wild_spirits
2:06.013 trickshots O steady_shot Fluffy_Pillow 27.8/100: 28% focus blood_fury, precise_shots, trick_shots, trueshot, wild_spirits
2:07.496 trickshots F steady_shot Fluffy_Pillow 55.9/100: 56% focus blood_fury, precise_shots, trick_shots, trueshot, wild_spirits
2:08.981 trickshots J aimed_shot Fluffy_Pillow 84.1/100: 84% focus blood_fury, precise_shots, steady_focus, trick_shots, trueshot, wild_spirits
2:10.170 trickshots L multishot Fluffy_Pillow 60.4/100: 60% focus blood_fury, precise_shots(2), steady_focus, trueshot, wild_spirits
2:11.358 trickshots J aimed_shot Fluffy_Pillow 51.7/100: 52% focus blood_fury, lock_and_load, precise_shots, steady_focus, trick_shots, trueshot, wild_spirits
2:12.545 trickshots L multishot Fluffy_Pillow 63.0/100: 63% focus blood_fury, precise_shots(2), steady_focus, trueshot, wild_spirits
2:13.732 trickshots J aimed_shot Fluffy_Pillow 54.2/100: 54% focus blood_fury, precise_shots, steady_focus, trick_shots, trueshot, wild_spirits
2:14.921 trickshots L multishot Fluffy_Pillow 30.5/100: 31% focus blood_fury, precise_shots(2), steady_focus, trueshot, wild_spirits
2:16.110 trickshots K rapid_fire Fluffy_Pillow 21.8/100: 22% focus blood_fury, precise_shots, steady_focus, trick_shots, trueshot, wild_spirits
2:17.970 trickshots L multishot Fluffy_Pillow 48.5/100: 48% focus blood_fury, precise_shots, steady_focus, trueshot, wild_spirits
2:19.159 trickshots J aimed_shot Fluffy_Pillow 39.7/100: 40% focus steady_focus, trick_shots, trueshot, wild_spirits
2:20.348 trickshots O steady_shot Fluffy_Pillow 16.0/100: 16% focus precise_shots(2), steady_focus, trueshot, wild_spirits
2:21.735 trickshots F steady_shot Fluffy_Pillow 44.2/100: 44% focus precise_shots(2), steady_focus, trueshot
2:23.120 trickshots L multishot Fluffy_Pillow 72.3/100: 72% focus lock_and_load, precise_shots(2), steady_focus
2:24.305 trickshots J aimed_shot Fluffy_Pillow 59.8/100: 60% focus lock_and_load, precise_shots, steady_focus, trick_shots
2:25.494 trickshots L multishot Fluffy_Pillow 67.4/100: 67% focus precise_shots(2), steady_focus
2:26.685 trickshots K rapid_fire Fluffy_Pillow 54.9/100: 55% focus precise_shots, steady_focus, trick_shots
2:28.425 trickshots L multishot Fluffy_Pillow 72.9/100: 73% focus precise_shots, steady_focus
2:29.614 trickshots J aimed_shot Fluffy_Pillow 60.4/100: 60% focus steady_focus, trick_shots
2:31.593 trickshots L multishot Fluffy_Pillow 38.0/100: 38% focus precise_shots(2), steady_focus
2:32.782 trickshots O steady_shot Fluffy_Pillow 25.5/100: 26% focus precise_shots, steady_focus, trick_shots
2:34.171 trickshots F steady_shot Fluffy_Pillow 44.3/100: 44% focus precise_shots, steady_focus, trick_shots
2:35.558 trickshots L multishot Fluffy_Pillow 63.1/100: 63% focus precise_shots, steady_focus, trick_shots
2:36.746 trickshots J aimed_shot Fluffy_Pillow 50.6/100: 51% focus steady_focus, trick_shots
2:38.725 trickshots L multishot Fluffy_Pillow 28.1/100: 28% focus precise_shots(2), steady_focus
2:39.914 trickshots O steady_shot Fluffy_Pillow 15.6/100: 16% focus precise_shots, steady_focus, trick_shots
2:41.300 trickshots O steady_shot Fluffy_Pillow 34.4/100: 34% focus precise_shots, steady_focus, trick_shots
2:42.686 trickshots O steady_shot Fluffy_Pillow 53.2/100: 53% focus precise_shots, steady_focus, trick_shots
2:44.075 trickshots L multishot Fluffy_Pillow 72.0/100: 72% focus precise_shots, steady_focus, trick_shots
2:45.265 trickshots J aimed_shot Fluffy_Pillow 59.5/100: 60% focus steady_focus, trick_shots
2:47.244 trickshots L multishot Fluffy_Pillow 37.0/100: 37% focus precise_shots(2), steady_focus
2:48.432 trickshots K rapid_fire Fluffy_Pillow 24.6/100: 25% focus precise_shots, steady_focus, trick_shots
2:50.238 trickshots L multishot Fluffy_Pillow 43.0/100: 43% focus precise_shots, steady_focus
2:51.428 trickshots G double_tap Fluffy_Pillow 30.5/100: 31% focus steady_focus, trick_shots
2:52.615 trickshots J aimed_shot Fluffy_Pillow 38.0/100: 38% focus double_tap, steady_focus, trick_shots
2:54.722 trickshots O steady_shot Fluffy_Pillow 16.4/100: 16% focus precise_shots(2), steady_focus
2:56.109 trickshots F steady_shot Fluffy_Pillow 35.1/100: 35% focus precise_shots(2), steady_focus
2:57.495 trickshots L multishot Fluffy_Pillow 53.9/100: 54% focus precise_shots(2), steady_focus
2:58.683 trickshots O steady_shot Fluffy_Pillow 41.4/100: 41% focus precise_shots, steady_focus, trick_shots
3:00.070 trickshots L multishot Fluffy_Pillow 60.2/100: 60% focus precise_shots, steady_focus, trick_shots
3:01.260 default 9 use_items Fluffy_Pillow 47.7/100: 48% focus steady_focus, trick_shots
3:01.260 trickshots O steady_shot Fluffy_Pillow 47.7/100: 48% focus steady_focus, trick_shots
3:02.646 trickshots J aimed_shot Fluffy_Pillow 66.5/100: 67% focus steady_focus, trick_shots
3:04.624 trickshots L multishot Fluffy_Pillow 44.0/100: 44% focus precise_shots(2), steady_focus
3:05.813 trickshots O steady_shot Fluffy_Pillow 31.6/100: 32% focus precise_shots, steady_focus, trick_shots
3:07.200 trickshots O steady_shot Fluffy_Pillow 50.3/100: 50% focus precise_shots, steady_focus, trick_shots
3:08.586 trickshots K rapid_fire Fluffy_Pillow 69.1/100: 69% focus precise_shots, steady_focus, trick_shots
3:10.294 trickshots L multishot Fluffy_Pillow 86.9/100: 87% focus precise_shots, steady_focus
3:11.482 trickshots J aimed_shot Fluffy_Pillow 74.4/100: 74% focus steady_focus, trick_shots
3:13.679 trickshots L multishot Fluffy_Pillow 53.3/100: 53% focus lock_and_load, precise_shots, steady_focus
3:14.868 trickshots J aimed_shot Fluffy_Pillow 40.9/100: 41% focus lock_and_load, steady_focus, trick_shots
3:16.058 trickshots L multishot Fluffy_Pillow 48.4/100: 48% focus lock_and_load, precise_shots(2), steady_focus
3:17.246 trickshots L multishot Fluffy_Pillow 35.9/100: 36% focus lock_and_load, precise_shots, steady_focus, trick_shots
3:18.435 trickshots J aimed_shot Fluffy_Pillow 23.4/100: 23% focus lock_and_load, steady_focus, trick_shots
3:19.623 trickshots L multishot Fluffy_Pillow 31.0/100: 31% focus precise_shots, steady_focus
3:20.812 trickshots O steady_shot Fluffy_Pillow 18.5/100: 18% focus steady_focus, trick_shots
3:22.198 trickshots F steady_shot Fluffy_Pillow 37.3/100: 37% focus steady_focus, trick_shots
3:23.586 trickshots J aimed_shot Fluffy_Pillow 56.1/100: 56% focus steady_focus, trick_shots
3:25.565 trickshots L multishot Fluffy_Pillow 33.6/100: 34% focus precise_shots, steady_focus
3:26.754 trickshots O steady_shot Fluffy_Pillow 21.1/100: 21% focus steady_focus, trick_shots
3:28.139 trickshots O steady_shot Fluffy_Pillow 39.9/100: 40% focus steady_focus, trick_shots
3:29.524 trickshots K rapid_fire Fluffy_Pillow 58.6/100: 59% focus steady_focus, trick_shots
3:31.308 trickshots L multishot Fluffy_Pillow 76.9/100: 77% focus steady_focus
3:32.495 trickshots J aimed_shot Fluffy_Pillow 64.4/100: 64% focus steady_focus, trick_shots
3:34.613 trickshots L multishot Fluffy_Pillow 42.8/100: 43% focus precise_shots(2), steady_focus
3:35.799 trickshots O steady_shot Fluffy_Pillow 30.3/100: 30% focus precise_shots, steady_focus, trick_shots
3:37.187 trickshots O steady_shot Fluffy_Pillow 49.1/100: 49% focus precise_shots, steady_focus, trick_shots
3:38.574 trickshots L multishot Fluffy_Pillow 67.9/100: 68% focus precise_shots, steady_focus, trick_shots
3:39.761 trickshots N multishot Fluffy_Pillow 55.4/100: 55% focus steady_focus, trick_shots
3:40.949 trickshots O steady_shot Fluffy_Pillow 42.9/100: 43% focus steady_focus, trick_shots
3:42.336 trickshots J aimed_shot Fluffy_Pillow 61.7/100: 62% focus steady_focus, trick_shots
3:44.315 trickshots L multishot Fluffy_Pillow 39.2/100: 39% focus lock_and_load, precise_shots, steady_focus
3:45.503 trickshots J aimed_shot Fluffy_Pillow 26.8/100: 27% focus lock_and_load, steady_focus, trick_shots
3:46.692 trickshots L multishot Fluffy_Pillow 34.3/100: 34% focus lock_and_load, precise_shots(2), steady_focus
3:47.882 trickshots L multishot Fluffy_Pillow 21.8/100: 22% focus lock_and_load, precise_shots, steady_focus, trick_shots
3:49.071 trickshots J aimed_shot Fluffy_Pillow 9.4/100: 9% focus lock_and_load, steady_focus, trick_shots
3:50.259 trickshots O steady_shot Fluffy_Pillow 16.9/100: 17% focus precise_shots, steady_focus
3:51.645 trickshots F steady_shot Fluffy_Pillow 35.6/100: 36% focus precise_shots, steady_focus
3:53.032 trickshots G double_tap Fluffy_Pillow 54.4/100: 54% focus precise_shots, steady_focus
3:54.220 trickshots L multishot Fluffy_Pillow 61.9/100: 62% focus double_tap, precise_shots, steady_focus
3:55.408 trickshots J aimed_shot Fluffy_Pillow 49.5/100: 49% focus double_tap, steady_focus, trick_shots
3:57.385 trickshots L multishot Fluffy_Pillow 27.0/100: 27% focus precise_shots, steady_focus
3:58.573 trickshots K rapid_fire Fluffy_Pillow 14.5/100: 14% focus steady_focus, trick_shots
4:00.358 trickshots L multishot Fluffy_Pillow 32.8/100: 33% focus steady_focus
4:01.548 trickshots O steady_shot Fluffy_Pillow 20.3/100: 20% focus steady_focus, trick_shots
4:02.934 trickshots H wild_spirits Fluffy_Pillow 39.1/100: 39% focus steady_focus, trick_shots
4:04.122 trickshots I trueshot Fluffy_Pillow 46.6/100: 47% focus steady_focus, trick_shots
4:04.122 cds D blood_fury Fluffy_Pillow 46.6/100: 47% focus steady_focus, trick_shots, trueshot
4:04.122 trickshots J aimed_shot Fluffy_Pillow 46.6/100: 47% focus blood_fury, steady_focus, trick_shots, trueshot
4:05.311 trickshots L multishot Fluffy_Pillow 22.9/100: 23% focus blood_fury, precise_shots(2), steady_focus, trueshot, wild_spirits
4:06.501 trickshots O steady_shot Fluffy_Pillow 14.2/100: 14% focus blood_fury, precise_shots, steady_focus, trick_shots, trueshot, wild_spirits
4:07.889 trickshots F steady_shot Fluffy_Pillow 42.4/100: 42% focus blood_fury, precise_shots, steady_focus, trick_shots, trueshot, wild_spirits
4:09.277 trickshots J aimed_shot Fluffy_Pillow 69.8/100: 70% focus blood_fury, precise_shots, steady_focus, trick_shots, trueshot, wild_spirits
4:10.465 trickshots L multishot Fluffy_Pillow 46.1/100: 46% focus blood_fury, precise_shots(2), steady_focus, trueshot, wild_spirits
4:11.652 trickshots J aimed_shot Fluffy_Pillow 37.3/100: 37% focus blood_fury, precise_shots, steady_focus, trick_shots, trueshot, wild_spirits
4:12.841 trickshots O steady_shot Fluffy_Pillow 13.6/100: 14% focus blood_fury, precise_shots(2), steady_focus, trueshot, wild_spirits
4:14.226 trickshots L multishot Fluffy_Pillow 41.8/100: 42% focus blood_fury, precise_shots(2), steady_focus, trueshot, wild_spirits
4:15.415 trickshots K rapid_fire Fluffy_Pillow 33.1/100: 33% focus blood_fury, precise_shots, steady_focus, trick_shots, trueshot, wild_spirits
4:17.162 trickshots L multishot Fluffy_Pillow 58.6/100: 59% focus blood_fury, precise_shots, steady_focus, trueshot, wild_spirits
4:18.349 trickshots J aimed_shot Fluffy_Pillow 49.9/100: 50% focus blood_fury, steady_focus, trick_shots, trueshot, wild_spirits
4:19.536 trickshots L multishot Fluffy_Pillow 26.2/100: 26% focus precise_shots, steady_focus, trueshot, wild_spirits
4:20.723 trickshots O steady_shot Fluffy_Pillow 17.4/100: 17% focus steady_focus, trick_shots, trueshot, wild_spirits
4:22.109 trickshots F steady_shot Fluffy_Pillow 45.6/100: 46% focus steady_focus, trick_shots, trueshot, wild_spirits
4:23.496 trickshots J aimed_shot Fluffy_Pillow 73.8/100: 74% focus steady_focus, trick_shots, trueshot
4:24.683 trickshots L multishot Fluffy_Pillow 47.2/100: 47% focus precise_shots(2), steady_focus
4:25.872 trickshots K rapid_fire Fluffy_Pillow 34.7/100: 35% focus precise_shots, steady_focus, trick_shots
4:27.705 trickshots L multishot Fluffy_Pillow 53.3/100: 53% focus precise_shots, steady_focus
4:28.892 trickshots J aimed_shot Fluffy_Pillow 40.8/100: 41% focus steady_focus, trick_shots
4:30.870 trickshots O steady_shot Fluffy_Pillow 18.3/100: 18% focus precise_shots(2), steady_focus
4:32.256 default 9 use_items Fluffy_Pillow 37.1/100: 37% focus precise_shots(2), steady_focus
4:32.256 trickshots L multishot Fluffy_Pillow 37.1/100: 37% focus precise_shots(2), steady_focus
4:33.445 trickshots O steady_shot Fluffy_Pillow 24.6/100: 25% focus precise_shots, steady_focus, trick_shots
4:34.833 trickshots F steady_shot Fluffy_Pillow 43.4/100: 43% focus precise_shots, steady_focus, trick_shots
4:36.221 trickshots L multishot Fluffy_Pillow 62.2/100: 62% focus precise_shots, steady_focus, trick_shots
4:37.410 trickshots J aimed_shot Fluffy_Pillow 49.7/100: 50% focus steady_focus, trick_shots
4:39.387 trickshots L multishot Fluffy_Pillow 27.2/100: 27% focus precise_shots, steady_focus
4:40.577 trickshots O steady_shot Fluffy_Pillow 14.8/100: 15% focus steady_focus, trick_shots
4:41.963 trickshots O steady_shot Fluffy_Pillow 33.5/100: 34% focus steady_focus, trick_shots
4:43.349 trickshots J aimed_shot Fluffy_Pillow 52.3/100: 52% focus steady_focus, trick_shots
4:45.420 trickshots L multishot Fluffy_Pillow 30.4/100: 30% focus lock_and_load, precise_shots(2), steady_focus
4:46.608 trickshots K rapid_fire Fluffy_Pillow 17.9/100: 18% focus lock_and_load, precise_shots, steady_focus, trick_shots
4:48.447 trickshots L multishot Fluffy_Pillow 36.6/100: 37% focus lock_and_load, precise_shots, steady_focus
4:49.635 trickshots J aimed_shot Fluffy_Pillow 24.1/100: 24% focus lock_and_load, steady_focus, trick_shots
4:50.823 trickshots L multishot Fluffy_Pillow 31.6/100: 32% focus precise_shots, steady_focus
4:52.010 trickshots M kill_shot Fluffy_Pillow 19.1/100: 19% focus steady_focus, trick_shots
4:53.197 trickshots G double_tap Fluffy_Pillow 16.6/100: 17% focus steady_focus, trick_shots
4:54.388 trickshots O steady_shot Fluffy_Pillow 24.2/100: 24% focus double_tap, steady_focus, trick_shots
4:55.776 trickshots F steady_shot Fluffy_Pillow 43.0/100: 43% focus double_tap, steady_focus, trick_shots
4:57.163 trickshots J aimed_shot Fluffy_Pillow 61.7/100: 62% focus double_tap, steady_focus, trick_shots
4:59.140 trickshots L multishot Fluffy_Pillow 39.2/100: 39% focus precise_shots, steady_focus
5:00.328 trickshots O steady_shot Fluffy_Pillow 26.8/100: 27% focus steady_focus, trick_shots
5:01.715 trickshots O steady_shot Fluffy_Pillow 45.5/100: 46% focus steady_focus, trick_shots
5:03.102 trickshots M kill_shot Fluffy_Pillow 64.3/100: 64% focus steady_focus, trick_shots
5:04.291 trickshots J aimed_shot Fluffy_Pillow 61.8/100: 62% focus steady_focus, trick_shots
5:06.354 trickshots L multishot Fluffy_Pillow 39.9/100: 40% focus precise_shots, steady_focus
5:07.542 trickshots K rapid_fire Fluffy_Pillow 27.4/100: 27% focus steady_focus, trick_shots
5:09.297 trickshots L multishot Fluffy_Pillow 45.5/100: 46% focus steady_focus
5:10.484 trickshots O steady_shot Fluffy_Pillow 33.0/100: 33% focus steady_focus, trick_shots
5:11.871 trickshots O steady_shot Fluffy_Pillow 51.8/100: 52% focus steady_focus, trick_shots
5:13.260 trickshots M kill_shot Fluffy_Pillow 70.6/100: 71% focus steady_focus, trick_shots
5:14.449 trickshots J aimed_shot Fluffy_Pillow 68.1/100: 68% focus steady_focus, trick_shots
5:16.429 trickshots L multishot Fluffy_Pillow 45.7/100: 46% focus precise_shots, steady_focus
5:17.615 trickshots O steady_shot Fluffy_Pillow 33.2/100: 33% focus steady_focus, trick_shots
5:19.001 trickshots O steady_shot Fluffy_Pillow 51.9/100: 52% focus steady_focus, trick_shots
5:20.388 trickshots N multishot Fluffy_Pillow 70.7/100: 71% focus steady_focus, trick_shots
5:21.577 trickshots N multishot Fluffy_Pillow 58.3/100: 58% focus steady_focus, trick_shots
5:22.766 trickshots O steady_shot Fluffy_Pillow 45.8/100: 46% focus steady_focus, trick_shots
5:24.153 trickshots J aimed_shot Fluffy_Pillow 64.6/100: 65% focus steady_focus, trick_shots
5:26.133 trickshots L multishot Fluffy_Pillow 42.1/100: 42% focus precise_shots, steady_focus
5:27.323 cds E potion Fluffy_Pillow 29.6/100: 30% focus steady_focus, trick_shots
5:27.323 trickshots K rapid_fire Fluffy_Pillow 29.6/100: 30% focus steady_focus, trick_shots, potion_of_spectral_agility
5:29.342 trickshots L multishot Fluffy_Pillow 49.4/100: 49% focus steady_focus, potion_of_spectral_agility
5:30.531 trickshots M kill_shot Fluffy_Pillow 36.9/100: 37% focus steady_focus, trick_shots, potion_of_spectral_agility
5:31.720 trickshots O steady_shot Fluffy_Pillow 34.4/100: 34% focus steady_focus, trick_shots, potion_of_spectral_agility
5:33.108 trickshots F steady_shot Fluffy_Pillow 53.2/100: 53% focus lock_and_load, steady_focus, trick_shots, potion_of_spectral_agility
5:34.495 trickshots J aimed_shot Fluffy_Pillow 72.0/100: 72% focus lock_and_load, steady_focus, trick_shots, potion_of_spectral_agility
5:35.683 trickshots L multishot Fluffy_Pillow 79.5/100: 80% focus lock_and_load, precise_shots, steady_focus, potion_of_spectral_agility
5:36.872 trickshots J aimed_shot Fluffy_Pillow 67.1/100: 67% focus lock_and_load, steady_focus, trick_shots, potion_of_spectral_agility
5:38.060 trickshots L multishot Fluffy_Pillow 74.6/100: 75% focus lock_and_load, precise_shots, steady_focus, potion_of_spectral_agility
5:39.246 trickshots J aimed_shot Fluffy_Pillow 62.1/100: 62% focus lock_and_load, steady_focus, trick_shots, potion_of_spectral_agility
5:40.434 trickshots L multishot Fluffy_Pillow 69.6/100: 70% focus precise_shots, steady_focus, potion_of_spectral_agility
5:41.622 trickshots J aimed_shot Fluffy_Pillow 57.1/100: 57% focus steady_focus, trick_shots, potion_of_spectral_agility
5:43.600 trickshots L multishot Fluffy_Pillow 34.6/100: 35% focus precise_shots, steady_focus, potion_of_spectral_agility
5:44.788 trickshots M kill_shot Fluffy_Pillow 22.2/100: 22% focus steady_focus, trick_shots, potion_of_spectral_agility
5:45.977 trickshots O steady_shot Fluffy_Pillow 19.7/100: 20% focus steady_focus, trick_shots, potion_of_spectral_agility
5:47.364 trickshots F steady_shot Fluffy_Pillow 38.5/100: 38% focus steady_focus, trick_shots, potion_of_spectral_agility
5:48.751 trickshots J aimed_shot Fluffy_Pillow 57.2/100: 57% focus steady_focus, trick_shots, potion_of_spectral_agility
5:50.729 trickshots L multishot Fluffy_Pillow 34.8/100: 35% focus precise_shots, steady_focus, potion_of_spectral_agility
5:51.917 trickshots K rapid_fire Fluffy_Pillow 22.3/100: 22% focus steady_focus, trick_shots, potion_of_spectral_agility

Stats

Level Bonus (60) Race Bonus (orc) Raid-Buffed Unbuffed Gear Amount
Strength 274 3 295 277 0
Agility 450 -3 1411 1297 789 (677)
Stamina 414 1 1800 1715 1300
Intellect 369 -1 405 368 0
Spirit 0 0 0 0 0
Health 36000 34300 0
Focus 100 100 0
Spell Power 405 368 0
Crit 22.66% 22.66% 443
Haste 18.30% 18.30% 604
Versatility 3.65% 3.65% 146
Attack Power 1482 1297 0
Mastery 14.00% 14.00% 504
Armor 818 818 818
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 217.00
Local Head Helm of Insatiable Appetite
ilevel: 213, stats: { 103 Armor, +126 Sta, +92 Haste, +40 Mastery, +72 AgiInt }
Local Neck Noble's Birthstone Pendant
ilevel: 213, stats: { +71 Sta, +47 Crit, +147 Mastery }
Local Shoulders Boneshatter Pauldrons
ilevel: 235, stats: { 107 Armor, +124 Sta, +44 unknown(24), +44 unknown(25), +66 AgiInt }
item effects: { equip: Nesingwary's Trapping Apparatus }
Local Chest Master Huntsman's Bandolier
ilevel: 213, stats: { 137 Armor, +126 Sta, +45 Crit, +86 Mastery, +72 AgiInt }, enchant: { +20 StrAgi }
Local Waist Load-Bearing Belt
ilevel: 213, stats: { 77 Armor, +95 Sta, +69 Haste, +30 Vers, +54 AgiInt }
Local Legs Greaves of Enigmatic Energies
ilevel: 213, stats: { 120 Armor, +126 Sta, +91 Crit, +41 Mastery, +72 AgiInt }
Local Feet Stoneclas Stompers
ilevel: 213, stats: { 86 Armor, +95 Sta, +69 Crit, +30 Mastery, +54 AgiInt }, enchant: { +15 Agi }
Local Wrists Bangles of Errant Pride
ilevel: 213, stats: { 69 Armor, +71 Sta, +48 Crit, +24 Mastery, +40 AgiInt }
Local Hands Oathsworn Soldier's Gauntlets
ilevel: 220, stats: { 80 Armor, +104 Sta, +67 Crit, +36 Haste, +58 AgiInt }
Local Finger1 Most Regal Signet of Sire Denathrius
ilevel: 220, stats: { +77 Sta, +161 Haste, +44 Mastery }, enchant: { +16 Crit }
item effects: { equip: Denathrius' Privilege }
Local Finger2 Ritualist's Treasured Ring
ilevel: 213, stats: { +71 Sta, +44 Crit, +149 Haste }, enchant: { +16 Crit }
Local Trinket1 Dreadfire Vessel
ilevel: 220, stats: { +73 StrAgiInt }, enchant: shadowcore_oil
item effects: { use: Dreadfire Vessel }
Local Trinket2 Stone Legion Heraldry
ilevel: 220, stats: { +73 StrAgi }
item effects: { equip: Stone Legionnaire }
Local Back Crest of the Legionnaire General
ilevel: 220, stats: { 39 Armor, +77 Sta, +52 Haste, +24 Vers, +43 StrAgiInt }
Local Main Hand Deadeye Blunderbuss
ilevel: 220, weapon: { 121 - 227, 3 }, stats: { +77 Agi, +137 Sta, +45 Haste, +92 Mastery }, enchant: sinful_revelation

Profile

hunter="trapping_app"
source=default
spec=marksmanship
level=60
race=orc
role=attack
position=ranged_back
talents=1101032
covenant=night_fae
soulbind=140:6//188:6

# Default consumables
potion=spectral_agility
flask=spectral_flask_of_power
food=feast_of_gluttonous_hedonism
augmentation=veiled

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask
actions.precombat+=/augmentation
actions.precombat+=/food
# Snapshot raid buffed stats before combat begins and pre-potting is done.
actions.precombat+=/snapshot_stats
actions.precombat+=/tar_trap,if=runeforge.soulforge_embers
actions.precombat+=/double_tap,precast_time=10,if=!covenant.kyrian&(!talent.volley|active_enemies<2)
actions.precombat+=/aimed_shot,if=active_enemies<3
actions.precombat+=/steady_shot,if=active_enemies>2

# Executed every time the actor is available.
actions=auto_shot
actions+=/counter_shot,line_cd=30,if=runeforge.sephuzs_proclamation|soulbind.niyas_tools_poison|(conduit.reversal_of_fortune&!runeforge.sephuzs_proclamation)
actions+=/use_items
actions+=/call_action_list,name=cds
actions+=/call_action_list,name=st,if=active_enemies<3
actions+=/call_action_list,name=trickshots,if=active_enemies>2

actions.cds=berserking,if=buff.trueshot.up|target.time_to_die<13
actions.cds+=/blood_fury,if=buff.trueshot.up|target.time_to_die<16
actions.cds+=/ancestral_call,if=buff.trueshot.up|target.time_to_die<16
actions.cds+=/fireblood,if=buff.trueshot.up|target.time_to_die<9
actions.cds+=/lights_judgment,if=buff.trueshot.down
actions.cds+=/bag_of_tricks,if=buff.trueshot.down
actions.cds+=/potion,if=buff.trueshot.up&buff.bloodlust.up|buff.trueshot.up&target.health.pct<20|target.time_to_die<26

actions.st=steady_shot,if=talent.steady_focus&(prev_gcd.1.steady_shot&buff.steady_focus.remains<5|buff.steady_focus.down)
actions.st+=/kill_shot
actions.st+=/double_tap,if=covenant.kyrian&cooldown.resonating_arrow.remains<gcd|!covenant.kyrian&(cooldown.aimed_shot.up|cooldown.rapid_fire.remains>cooldown.aimed_shot.remains)
actions.st+=/flare,if=tar_trap.up&runeforge.soulforge_embers
actions.st+=/tar_trap,if=runeforge.soulforge_embers&tar_trap.remains<gcd&cooldown.flare.remains<gcd
actions.st+=/explosive_shot
actions.st+=/wild_spirits
actions.st+=/flayed_shot
actions.st+=/death_chakram,if=focus+cast_regen<focus.max
actions.st+=/volley,if=buff.precise_shots.down|!talent.chimaera_shot|active_enemies<2
actions.st+=/a_murder_of_crows
actions.st+=/resonating_arrow
actions.st+=/trueshot,if=buff.precise_shots.down|buff.resonating_arrow.up|buff.wild_spirits.up|buff.volley.up&active_enemies>1
actions.st+=/aimed_shot,target_if=min:(dot.serpent_sting.remains<?action.serpent_sting.in_flight_to_target*dot.serpent_sting.duration),if=buff.precise_shots.down|(buff.trueshot.up|full_recharge_time<gcd+cast_time)&(!talent.chimaera_shot|active_enemies<2)|buff.trick_shots.remains>execute_time&active_enemies>1
actions.st+=/rapid_fire,if=focus+cast_regen<focus.max&(buff.trueshot.down|!runeforge.eagletalons_true_focus)&(buff.double_tap.down|talent.streamline)
actions.st+=/chimaera_shot,if=buff.precise_shots.up|focus>cost+action.aimed_shot.cost
actions.st+=/arcane_shot,if=buff.precise_shots.up|focus>cost+action.aimed_shot.cost
actions.st+=/serpent_sting,target_if=min:remains,if=refreshable&target.time_to_die>duration
actions.st+=/barrage,if=active_enemies>1
actions.st+=/rapid_fire,if=focus+cast_regen<focus.max&(buff.double_tap.down|talent.streamline)
actions.st+=/steady_shot

actions.trickshots=steady_shot,if=talent.steady_focus&in_flight&buff.steady_focus.remains<5
actions.trickshots+=/double_tap,if=covenant.kyrian&cooldown.resonating_arrow.remains<gcd|cooldown.rapid_fire.remains<cooldown.aimed_shot.full_recharge_time|!(talent.streamline&runeforge.surging_shots)|!covenant.kyrian
actions.trickshots+=/tar_trap,if=runeforge.soulforge_embers&tar_trap.remains<gcd&cooldown.flare.remains<gcd
actions.trickshots+=/flare,if=tar_trap.up&runeforge.soulforge_embers
actions.trickshots+=/explosive_shot
actions.trickshots+=/wild_spirits
actions.trickshots+=/resonating_arrow
actions.trickshots+=/volley
actions.trickshots+=/barrage
actions.trickshots+=/trueshot
actions.trickshots+=/rapid_fire,if=buff.trick_shots.remains>=execute_time&runeforge.surging_shots&buff.double_tap.down
actions.trickshots+=/aimed_shot,target_if=min:(dot.serpent_sting.remains<?action.serpent_sting.in_flight_to_target*dot.serpent_sting.duration),if=buff.trick_shots.remains>=execute_time&(buff.precise_shots.down|full_recharge_time<cast_time+gcd|buff.trueshot.up)
actions.trickshots+=/death_chakram,if=focus+cast_regen<focus.max
actions.trickshots+=/rapid_fire,if=buff.trick_shots.remains>=execute_time
actions.trickshots+=/multishot,if=buff.trick_shots.down|buff.precise_shots.up&focus>cost+action.aimed_shot.cost&(!talent.chimaera_shot|active_enemies>3)
actions.trickshots+=/chimaera_shot,if=buff.precise_shots.up&focus>cost+action.aimed_shot.cost&active_enemies<4
actions.trickshots+=/kill_shot,if=buff.dead_eye.down
actions.trickshots+=/a_murder_of_crows
actions.trickshots+=/flayed_shot
actions.trickshots+=/serpent_sting,target_if=min:dot.serpent_sting.remains,if=refreshable
actions.trickshots+=/multishot,if=focus>cost+action.aimed_shot.cost
actions.trickshots+=/steady_shot

head=helm_of_insatiable_appetite,id=183001,bonus_id=7188/1485,ilevel=213
neck=nobles_birthstone_pendant,id=183039,bonus_id=7188/1485,ilevel=213
shoulders=boneshatter_pauldrons,id=172327,bonus_id=7004,ilevel=235
back=crest_of_the_legionnaire_general,id=183032,bonus_id=6805,ilevel=220
chest=master_huntsmans_bandolier,id=182988,bonus_id=6805,ilevel=213,enchant=eternal_skirmish
wrists=bangles_of_errant_pride,id=182977,bonus_id=6805,ilevel=213
hands=oathsworn_soldiers_gauntlets,id=182991,bonus_id=6805,ilevel=220
waist=loadbearing_belt,id=183016,bonus_id=6805,ilevel=213
legs=greaves_of_enigmatic_energies,id=183012,bonus_id=6805,ilevel=213
feet=stoneclas_stompers,id=183006,bonus_id=6805,ilevel=213,enchant=15agility
finger1=most_regal_signet_of_sire_denathrius,id=183036,bonus_id=6805,ilevel=220,enchant=16crit
finger2=ritualists_treasured_ring,id=183037,bonus_id=6805,ilevel=213,enchant=16crit
trinket1=dreadfire_vessel,id=184030,bonus_id=6805,ilevel=220,enchant=shadowcore_oil
trinket2=stone_legion_heraldry,id=184027,bonus_id=6805,ilevel=220
main_hand=deadeye_blunderbuss,id=184250,bonus_id=6805,ilevel=220,enchant=sinful_revelation

# Gear Summary
# gear_ilvl=217.27
# gear_agility=789
# gear_stamina=1300
# gear_crit_rating=443
# gear_haste_rating=604
# gear_mastery_rating=504
# gear_versatility_rating=54
# gear_armor=818

Simulation & Raid Information

Iterations: 1233
Threads: 16
Confidence: 95.00%
Fight Length (fixed time): 240 - 360 ( 300.0 )

Performance:

Total Events Processed: 42646061
Max Event Queue: 506
Sim Seconds: 369858
CPU Seconds: 48.7656
Physical Seconds: 5.0006
Speed Up: 7584

Settings:

World Lag: 100 ms ( stddev = 10 ms )
Queue Lag: 5 ms ( stddev = 1 ms )

Raw Ability Summary

Character Unit Ability Id Total DPS Imp/Min Hit Crit Execute Count Crit% Avoid% G% B% Interval Combined Duration
call_ot_wild call_ot_wild aimed_shot 19434 1156466 3855 50.09 3760 7552 50.1 250.4 22.6% 0.0% 0.0% 0.0% 5.92sec 1651896 299.97sec
call_ot_wild call_ot_wild aimed_shot_double_tap 19434 114050 380 4.78 3873 7754 0.0 23.9 23.3% 0.0% 0.0% 0.0% 0.00sec 162910 299.97sec
call_ot_wild call_ot_wild augmentation 347901 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.97sec
call_ot_wild call_ot_wild auto_shot 75 110906 370 22.32 811 1621 111.8 111.6 22.6% 0.0% 0.0% 0.0% 2.69sec 158418 299.97sec
call_ot_wild call_ot_wild blood_fury 20572 0 0 0.00 0 0 2.7 0.0 0.0% 0.0% 0.0% 0.0% 151.10sec 0 299.97sec
call_ot_wild call_ot_wild double_tap 260402 0 0 0.00 0 0 5.6 0.0 0.0% 0.0% 0.0% 0.0% 60.65sec 0 299.97sec
call_ot_wild call_ot_wild dreadfire_vessel 344732 41224 137 0.74 9025 18036 3.7 3.7 22.8% 0.0% 0.0% 0.0% 90.72sec 41224 299.97sec
call_ot_wild call_ot_wild eternal_skirmish 323889 11933 40 4.35 446 892 21.8 21.8 22.9% 0.0% 0.0% 0.0% 13.77sec 11933 299.97sec
call_ot_wild call_ot_wild flask 307185 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.97sec
call_ot_wild call_ot_wild food 308462 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.97sec
call_ot_wild call_ot_wild kill_shot 53351 24294 81 0.89 4261 9561 4.5 4.4 22.7% 0.0% 0.0% 0.0% 13.95sec 34701 299.97sec
call_ot_wild call_ot_wild master_marksman ticks -269576 149366 498 105.62 283 0 312.8 528.1 0.0% 0.0% 0.0% 0.0% 0.98sec 149366 299.97sec
call_ot_wild call_ot_wild multishot 257620 814111 2714 81.00 1638 3279 81.2 405.0 22.7% 0.0% 0.0% 0.0% 3.68sec 1162877 299.97sec
call_ot_wild call_ot_wild potion 307159 0 0 0.00 0 0 1.5 0.0 0.0% 0.0% 0.0% 0.0% 307.19sec 0 299.97sec
call_ot_wild call_ot_wild rapid_fire ticks -257044 342908 1143 25.41 442 884 17.4 127.0 22.6% 0.0% 0.0% 0.0% 17.35sec 489810 299.97sec
call_ot_wild call_ot_wild shadowcore_oil_blast 336463 13155 44 8.74 245 491 43.7 43.7 22.7% 0.0% 0.0% 0.0% 6.76sec 13155 299.97sec
call_ot_wild call_ot_wild steady_shot 56641 101219 337 13.04 1266 2531 64.3 65.2 22.6% 0.0% 0.0% 0.0% 4.64sec 144582 299.97sec
call_ot_wild call_ot_wild trueshot 288613 0 0 0.00 0 0 4.4 0.0 0.0% 0.0% 0.0% 0.0% 78.65sec 0 299.97sec
call_ot_wild call_ot_wild wild_spirits 328231 14066 47 2.97 774 1545 3.0 14.8 22.5% 0.0% 0.0% 0.0% 120.61sec 14066 299.97sec
call_ot_wild call_ot_wild wild_spirits_proc 328757 375951 1253 41.91 1462 2923 41.9 209.5 22.7% 0.0% 0.0% 0.0% 6.17sec 375951 299.97sec
eagle_true_focus eagle_true_focus aimed_shot 19434 1254433 4182 53.22 3847 7692 53.3 266.1 22.6% 0.0% 0.0% 0.0% 5.60sec 1791832 299.97sec
eagle_true_focus eagle_true_focus aimed_shot_double_tap 19434 117747 393 4.99 3873 7681 0.0 24.9 22.3% 0.0% 0.0% 0.0% 0.00sec 168190 299.97sec
eagle_true_focus eagle_true_focus augmentation 347901 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.97sec
eagle_true_focus eagle_true_focus auto_shot 75 111692 372 22.45 811 1622 112.5 112.2 22.7% 0.0% 0.0% 0.0% 2.68sec 159541 299.97sec
eagle_true_focus eagle_true_focus blood_fury 20572 0 0 0.00 0 0 3.0 0.0 0.0% 0.0% 0.0% 0.0% 120.68sec 0 299.97sec
eagle_true_focus eagle_true_focus double_tap 260402 0 0 0.00 0 0 5.6 0.0 0.0% 0.0% 0.0% 0.0% 60.64sec 0 299.97sec
eagle_true_focus eagle_true_focus dreadfire_vessel 344732 41164 137 0.74 9038 18092 3.7 3.7 22.3% 0.0% 0.0% 0.0% 90.71sec 41164 299.97sec
eagle_true_focus eagle_true_focus eternal_skirmish 323889 11858 40 4.34 446 892 21.7 21.7 22.5% 0.0% 0.0% 0.0% 13.21sec 11858 299.97sec
eagle_true_focus eagle_true_focus flask 307185 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.97sec
eagle_true_focus eagle_true_focus food 308462 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.97sec
eagle_true_focus eagle_true_focus kill_shot 53351 21738 72 0.80 4215 9470 4.0 4.0 23.1% 0.0% 0.0% 0.0% 14.54sec 31050 299.97sec
eagle_true_focus eagle_true_focus master_marksman ticks -269576 155286 518 105.16 295 0 302.8 525.8 0.0% 0.0% 0.0% 0.0% 1.00sec 155286 299.97sec
eagle_true_focus eagle_true_focus multishot 257620 888617 2962 89.51 1619 3237 89.7 447.5 22.7% 0.0% 0.0% 0.0% 3.33sec 1269300 299.97sec
eagle_true_focus eagle_true_focus potion 307159 0 0 0.00 0 0 1.5 0.0 0.0% 0.0% 0.0% 0.0% 309.75sec 0 299.97sec
eagle_true_focus eagle_true_focus rapid_fire ticks -257044 291389 971 21.66 441 880 15.0 108.3 22.6% 0.0% 0.0% 0.0% 19.51sec 416221 299.97sec
eagle_true_focus eagle_true_focus shadowcore_oil_blast 336463 12976 43 8.60 245 491 43.0 43.0 22.9% 0.0% 0.0% 0.0% 6.85sec 12976 299.97sec
eagle_true_focus eagle_true_focus steady_shot 56641 85206 284 11.18 1243 2485 55.0 55.9 22.6% 0.0% 0.0% 0.0% 5.42sec 121708 299.97sec
eagle_true_focus eagle_true_focus trueshot 288613 0 0 0.00 0 0 3.0 0.0 0.0% 0.0% 0.0% 0.0% 120.70sec 0 299.97sec
eagle_true_focus eagle_true_focus wild_spirits 328231 14694 49 2.97 808 1614 3.0 14.8 22.7% 0.0% 0.0% 0.0% 120.56sec 14694 299.97sec
eagle_true_focus eagle_true_focus wild_spirits_proc 328757 416889 1390 45.21 1506 3011 45.2 226.0 22.5% 0.0% 0.0% 0.0% 5.68sec 416889 299.97sec
marksmanship marksmanship aimed_shot 19434 1054294 3515 46.27 3716 7428 46.3 231.3 22.7% 0.0% 0.0% 0.0% 6.50sec 1505953 299.97sec
marksmanship marksmanship aimed_shot_double_tap 19434 118982 397 5.12 3798 7611 0.0 25.6 22.4% 0.0% 0.0% 0.0% 0.00sec 169954 299.97sec
marksmanship marksmanship augmentation 347901 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.97sec
marksmanship marksmanship auto_shot 75 111785 373 22.64 805 1610 113.4 113.2 22.7% 0.0% 0.0% 0.0% 2.65sec 159674 299.97sec
marksmanship marksmanship blood_fury 20572 0 0 0.00 0 0 3.0 0.0 0.0% 0.0% 0.0% 0.0% 120.64sec 0 299.97sec
marksmanship marksmanship double_tap 260402 0 0 0.00 0 0 5.6 0.0 0.0% 0.0% 0.0% 0.0% 60.60sec 0 299.97sec
marksmanship marksmanship dreadfire_vessel 344732 41392 138 0.74 9043 18080 3.7 3.7 23.0% 0.0% 0.0% 0.0% 90.71sec 41392 299.97sec
marksmanship marksmanship eternal_skirmish 323889 11817 39 4.37 442 884 21.9 21.9 22.3% 0.0% 0.0% 0.0% 13.47sec 11817 299.97sec
marksmanship marksmanship flask 307185 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.97sec
marksmanship marksmanship food 308462 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.97sec
marksmanship marksmanship kill_shot 53351 25418 85 0.93 4227 9514 4.7 4.7 23.2% 0.0% 0.0% 0.0% 13.17sec 36308 299.97sec
marksmanship marksmanship master_marksman ticks -269576 140902 470 105.40 267 0 308.3 527.0 0.0% 0.0% 0.0% 0.0% 0.99sec 140902 299.97sec
marksmanship marksmanship multishot 257620 796958 2657 81.89 1586 3172 82.1 409.4 22.7% 0.0% 0.0% 0.0% 3.65sec 1138375 299.97sec
marksmanship marksmanship potion 307159 0 0 0.00 0 0 1.5 0.0 0.0% 0.0% 0.0% 0.0% 310.27sec 0 299.97sec
marksmanship marksmanship rapid_fire ticks -257044 308701 1029 23.00 439 876 16.1 115.0 22.7% 0.0% 0.0% 0.0% 18.87sec 440948 299.97sec
marksmanship marksmanship serpent_sting 271788 28186 94 9.24 499 997 0.0 46.2 22.3% 0.0% 0.0% 0.0% 0.00sec 244824 299.97sec
marksmanship marksmanship serpent_sting ticks -271788 216638 722 74.82 472 944 0.0 374.1 22.7% 0.0% 0.0% 0.0% 0.00sec 244824 299.97sec
marksmanship marksmanship shadowcore_oil_blast 336463 13091 44 8.80 242 484 44.0 44.0 22.9% 0.0% 0.0% 0.0% 6.70sec 13091 299.97sec
marksmanship marksmanship steady_shot 56641 107761 359 13.99 1257 2512 69.0 69.9 22.6% 0.0% 0.0% 0.0% 4.32sec 153926 299.97sec
marksmanship marksmanship trueshot 288613 0 0 0.00 0 0 3.0 0.0 0.0% 0.0% 0.0% 0.0% 120.64sec 0 299.97sec
no_lego no_lego aimed_shot 19434 1100651 3669 47.50 3786 7552 47.6 237.5 22.5% 0.0% 0.0% 0.0% 6.30sec 1572170 299.97sec
no_lego no_lego aimed_shot_double_tap 19434 109362 365 4.58 3888 7804 0.0 22.9 22.6% 0.0% 0.0% 0.0% 0.00sec 156213 299.97sec
no_lego no_lego augmentation 347901 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.97sec
no_lego no_lego auto_shot 75 111876 373 22.48 812 1623 112.6 112.4 22.7% 0.0% 0.0% 0.0% 2.67sec 159803 299.97sec
no_lego no_lego blood_fury 20572 0 0 0.00 0 0 3.0 0.0 0.0% 0.0% 0.0% 0.0% 120.80sec 0 299.97sec
no_lego no_lego double_tap 260402 0 0 0.00 0 0 5.6 0.0 0.0% 0.0% 0.0% 0.0% 60.60sec 0 299.97sec
no_lego no_lego dreadfire_vessel 344732 41608 139 0.74 9053 18102 3.7 3.7 23.6% 0.0% 0.0% 0.0% 90.74sec 41608 299.97sec
no_lego no_lego eternal_skirmish 323889 11926 40 4.36 446 892 21.8 21.8 22.5% 0.0% 0.0% 0.0% 13.49sec 11926 299.97sec
no_lego no_lego flask 307185 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.97sec
no_lego no_lego food 308462 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.97sec
no_lego no_lego kill_shot 53351 24842 83 0.92 4260 9559 4.6 4.6 21.6% 0.0% 0.0% 0.0% 13.24sec 35484 299.97sec
no_lego no_lego master_marksman ticks -269576 144401 481 103.97 278 0 304.2 519.9 0.0% 0.0% 0.0% 0.0% 1.01sec 144401 299.97sec
no_lego no_lego multishot 257620 807084 2691 81.29 1618 3237 81.5 406.4 22.7% 0.0% 0.0% 0.0% 3.67sec 1152838 299.97sec
no_lego no_lego potion 307159 0 0 0.00 0 0 1.5 0.0 0.0% 0.0% 0.0% 0.0% 309.77sec 0 299.97sec
no_lego no_lego rapid_fire ticks -257044 328519 1095 24.22 444 887 16.4 121.1 22.7% 0.0% 0.0% 0.0% 18.45sec 469257 299.97sec
no_lego no_lego shadowcore_oil_blast 336463 13149 44 8.75 245 491 43.7 43.7 22.5% 0.0% 0.0% 0.0% 6.70sec 13149 299.97sec
no_lego no_lego steady_shot 56641 104589 349 13.48 1266 2532 66.5 67.4 22.5% 0.0% 0.0% 0.0% 4.47sec 149394 299.97sec
no_lego no_lego trueshot 288613 0 0 0.00 0 0 3.0 0.0 0.0% 0.0% 0.0% 0.0% 120.82sec 0 299.97sec
no_lego no_lego wild_spirits 328231 14708 49 2.97 808 1614 3.0 14.8 22.8% 0.0% 0.0% 0.0% 120.68sec 14708 299.97sec
no_lego no_lego wild_spirits_proc 328757 402475 1342 43.68 1504 3007 43.7 218.4 22.6% 0.0% 0.0% 0.0% 5.88sec 402475 299.97sec
secrets_ot_unblinking_vigil secrets_ot_unblinking_vigil aimed_shot 19434 1370854 4570 59.60 3754 7503 59.7 298.0 22.6% 0.0% 0.0% 0.0% 4.99sec 1958128 299.97sec
secrets_ot_unblinking_vigil secrets_ot_unblinking_vigil aimed_shot_double_tap 19434 115875 386 4.88 3873 7627 0.0 24.4 23.2% 0.0% 0.0% 0.0% 0.00sec 165515 299.97sec
secrets_ot_unblinking_vigil secrets_ot_unblinking_vigil augmentation 347901 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.97sec
secrets_ot_unblinking_vigil secrets_ot_unblinking_vigil auto_shot 75 111803 373 22.52 809 1619 112.8 112.6 22.7% 0.0% 0.0% 0.0% 2.67sec 159700 299.97sec
secrets_ot_unblinking_vigil secrets_ot_unblinking_vigil blood_fury 20572 0 0 0.00 0 0 3.0 0.0 0.0% 0.0% 0.0% 0.0% 120.80sec 0 299.97sec
secrets_ot_unblinking_vigil secrets_ot_unblinking_vigil double_tap 260402 0 0 0.00 0 0 5.6 0.0 0.0% 0.0% 0.0% 0.0% 60.60sec 0 299.97sec
secrets_ot_unblinking_vigil secrets_ot_unblinking_vigil dreadfire_vessel 344732 41189 137 0.75 9031 18050 3.7 3.7 22.5% 0.0% 0.0% 0.0% 90.74sec 41189 299.97sec
secrets_ot_unblinking_vigil secrets_ot_unblinking_vigil eternal_skirmish 323889 11878 40 4.34 446 891 21.7 21.7 22.7% 0.0% 0.0% 0.0% 13.56sec 11878 299.97sec
secrets_ot_unblinking_vigil secrets_ot_unblinking_vigil flask 307185 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.97sec
secrets_ot_unblinking_vigil secrets_ot_unblinking_vigil food 308462 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.97sec
secrets_ot_unblinking_vigil secrets_ot_unblinking_vigil kill_shot 53351 20969 70 0.77 4245 9584 3.9 3.8 22.7% 0.0% 0.0% 0.0% 15.41sec 29952 299.97sec
secrets_ot_unblinking_vigil secrets_ot_unblinking_vigil master_marksman ticks -269576 160844 536 104.70 307 0 304.3 523.5 0.0% 0.0% 0.0% 0.0% 1.00sec 160844 299.97sec
secrets_ot_unblinking_vigil secrets_ot_unblinking_vigil multishot 257620 862910 2877 82.10 1714 3427 82.3 410.5 22.7% 0.0% 0.0% 0.0% 3.63sec 1232580 299.97sec
secrets_ot_unblinking_vigil secrets_ot_unblinking_vigil potion 307159 0 0 0.00 0 0 1.5 0.0 0.0% 0.0% 0.0% 0.0% 309.92sec 0 299.97sec
secrets_ot_unblinking_vigil secrets_ot_unblinking_vigil rapid_fire ticks -257044 302184 1007 22.20 445 890 15.2 111.0 22.7% 0.0% 0.0% 0.0% 19.75sec 431640 299.97sec
secrets_ot_unblinking_vigil secrets_ot_unblinking_vigil shadowcore_oil_blast 336463 13057 44 8.69 245 491 43.4 43.4 22.5% 0.0% 0.0% 0.0% 6.89sec 13057 299.97sec
secrets_ot_unblinking_vigil secrets_ot_unblinking_vigil steady_shot 56641 79951 267 10.32 1260 2521 50.7 51.6 23.0% 0.0% 0.0% 0.0% 5.87sec 114202 299.97sec
secrets_ot_unblinking_vigil secrets_ot_unblinking_vigil trueshot 288613 0 0 0.00 0 0 3.0 0.0 0.0% 0.0% 0.0% 0.0% 120.83sec 0 299.97sec
secrets_ot_unblinking_vigil secrets_ot_unblinking_vigil wild_spirits 328231 14641 49 2.96 807 1616 3.0 14.8 22.4% 0.0% 0.0% 0.0% 120.68sec 14641 299.97sec
secrets_ot_unblinking_vigil secrets_ot_unblinking_vigil wild_spirits_proc 328757 402905 1343 43.71 1504 3010 43.7 218.5 22.5% 0.0% 0.0% 0.0% 5.88sec 402905 299.97sec
serpentstalkers_trickery serpentstalkers_trickery aimed_shot 19434 1102478 3675 47.54 3775 7571 47.6 237.7 22.7% 0.0% 0.0% 0.0% 6.26sec 1574780 299.97sec
serpentstalkers_trickery serpentstalkers_trickery aimed_shot_double_tap 19434 109381 365 4.60 3872 7791 0.0 23.0 22.6% 0.0% 0.0% 0.0% 0.00sec 156240 299.97sec
serpentstalkers_trickery serpentstalkers_trickery augmentation 347901 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.97sec
serpentstalkers_trickery serpentstalkers_trickery auto_shot 75 111782 373 22.49 811 1621 112.7 112.4 22.6% 0.0% 0.0% 0.0% 2.68sec 159669 299.97sec
serpentstalkers_trickery serpentstalkers_trickery blood_fury 20572 0 0 0.00 0 0 3.0 0.0 0.0% 0.0% 0.0% 0.0% 120.81sec 0 299.97sec
serpentstalkers_trickery serpentstalkers_trickery double_tap 260402 0 0 0.00 0 0 5.6 0.0 0.0% 0.0% 0.0% 0.0% 60.59sec 0 299.97sec
serpentstalkers_trickery serpentstalkers_trickery dreadfire_vessel 344732 40784 136 0.74 9042 18062 3.7 3.7 21.3% 0.0% 0.0% 0.0% 90.78sec 40784 299.97sec
serpentstalkers_trickery serpentstalkers_trickery eternal_skirmish 323889 12015 40 4.39 446 892 22.0 22.0 22.7% 0.0% 0.0% 0.0% 13.41sec 12015 299.97sec
serpentstalkers_trickery serpentstalkers_trickery flask 307185 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.97sec
serpentstalkers_trickery serpentstalkers_trickery food 308462 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.97sec
serpentstalkers_trickery serpentstalkers_trickery kill_shot 53351 25036 83 0.92 4254 9559 4.6 4.6 22.8% 0.0% 0.0% 0.0% 13.43sec 35761 299.97sec
serpentstalkers_trickery serpentstalkers_trickery master_marksman ticks -269576 146601 489 106.03 276 0 313.9 530.1 0.0% 0.0% 0.0% 0.0% 0.97sec 146601 299.97sec
serpentstalkers_trickery serpentstalkers_trickery multishot 257620 807414 2692 81.31 1620 3239 81.5 406.5 22.6% 0.0% 0.0% 0.0% 3.67sec 1153311 299.97sec
serpentstalkers_trickery serpentstalkers_trickery potion 307159 0 0 0.00 0 0 1.5 0.0 0.0% 0.0% 0.0% 0.0% 309.75sec 0 299.97sec
serpentstalkers_trickery serpentstalkers_trickery rapid_fire ticks -257044 327322 1091 24.16 444 887 16.4 120.8 22.6% 0.0% 0.0% 0.0% 18.31sec 467547 299.97sec
serpentstalkers_trickery serpentstalkers_trickery serpent_sting 271788 29435 98 9.49 507 1014 0.0 47.5 22.4% 0.0% 0.0% 0.0% 0.00sec 253845 299.97sec
serpentstalkers_trickery serpentstalkers_trickery serpent_sting ticks -271788 224410 748 76.89 476 953 0.0 384.4 22.6% 0.0% 0.0% 0.0% 0.00sec 253845 299.97sec
serpentstalkers_trickery serpentstalkers_trickery shadowcore_oil_blast 336463 13160 44 8.77 244 488 43.8 43.8 22.9% 0.0% 0.0% 0.0% 6.81sec 13160 299.97sec
serpentstalkers_trickery serpentstalkers_trickery steady_shot 56641 104477 348 13.48 1264 2527 66.5 67.4 22.6% 0.0% 0.0% 0.0% 4.50sec 149235 299.97sec
serpentstalkers_trickery serpentstalkers_trickery trueshot 288613 0 0 0.00 0 0 3.0 0.0 0.0% 0.0% 0.0% 0.0% 120.83sec 0 299.97sec
serpentstalkers_trickery serpentstalkers_trickery wild_spirits 328231 14690 49 2.97 807 1616 3.0 14.8 22.6% 0.0% 0.0% 0.0% 120.69sec 14690 299.97sec
serpentstalkers_trickery serpentstalkers_trickery wild_spirits_proc 328757 522754 1743 56.65 1505 3010 56.6 283.2 22.6% 0.0% 0.0% 0.0% 4.52sec 522754 299.97sec
soulforge_embers soulforge_embers aimed_shot 19434 1076728 3590 46.36 3787 7565 46.4 231.8 22.7% 0.0% 0.0% 0.0% 6.40sec 1537999 299.97sec
soulforge_embers soulforge_embers aimed_shot_double_tap 19434 104229 347 4.39 3879 7731 0.0 21.9 22.7% 0.0% 0.0% 0.0% 0.00sec 148881 299.97sec
soulforge_embers soulforge_embers augmentation 347901 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.97sec
soulforge_embers soulforge_embers auto_shot 75 112910 376 22.66 812 1623 113.5 113.3 22.7% 0.0% 0.0% 0.0% 2.65sec 161280 299.97sec
soulforge_embers soulforge_embers blood_fury 20572 0 0 0.00 0 0 3.0 0.0 0.0% 0.0% 0.0% 0.0% 120.66sec 0 299.97sec
soulforge_embers soulforge_embers double_tap 260402 0 0 0.00 0 0 5.6 0.0 0.0% 0.0% 0.0% 0.0% 60.54sec 0 299.97sec
soulforge_embers soulforge_embers dreadfire_vessel 344732 41273 138 0.74 9038 18075 3.7 3.7 22.7% 0.0% 0.0% 0.0% 90.79sec 41273 299.97sec
soulforge_embers soulforge_embers eternal_skirmish 323889 11828 39 4.33 446 892 21.7 21.7 22.4% 0.0% 0.0% 0.0% 13.52sec 11828 299.97sec
soulforge_embers soulforge_embers flare 1543 0 0 0.00 0 0 14.4 0.0 0.0% 0.0% 0.0% 0.0% 21.46sec 0 299.97sec
soulforge_embers soulforge_embers flask 307185 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.97sec
soulforge_embers soulforge_embers food 308462 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.97sec
soulforge_embers soulforge_embers kill_shot 53351 22621 75 0.83 4246 9557 4.2 4.1 23.0% 0.0% 0.0% 0.0% 14.55sec 32312 299.97sec
soulforge_embers soulforge_embers master_marksman ticks -269576 139013 463 100.50 277 0 290.5 502.5 0.0% 0.0% 0.0% 0.0% 1.05sec 139013 299.97sec
soulforge_embers soulforge_embers multishot 257620 766247 2554 76.11 1642 3284 76.3 380.5 22.6% 0.0% 0.0% 0.0% 3.91sec 1094507 299.97sec
soulforge_embers soulforge_embers potion 307159 0 0 0.00 0 0 1.5 0.0 0.0% 0.0% 0.0% 0.0% 309.33sec 0 299.97sec
soulforge_embers soulforge_embers rapid_fire ticks -257044 320256 1068 23.66 443 887 15.8 118.3 22.6% 0.0% 0.0% 0.0% 19.11sec 457453 299.97sec
soulforge_embers soulforge_embers shadowcore_oil_blast 336463 13055 44 8.70 245 491 43.5 43.5 22.3% 0.0% 0.0% 0.0% 6.98sec 13055 299.97sec
soulforge_embers soulforge_embers soulforge_embers ticks -336746 570168 1901 116.44 798 1597 14.4 582.2 22.7% 0.0% 0.0% 0.0% 21.46sec 570168 299.97sec
soulforge_embers soulforge_embers steady_shot 56641 85998 287 11.12 1264 2528 54.7 55.6 22.4% 0.0% 0.0% 0.0% 5.43sec 122839 299.97sec
soulforge_embers soulforge_embers tar_trap 187698 0 0 0.00 0 0 7.5 0.0 0.0% 0.0% 0.0% 0.0% 43.11sec 0 299.97sec
soulforge_embers soulforge_embers trueshot 288613 0 0 0.00 0 0 3.0 0.0 0.0% 0.0% 0.0% 0.0% 120.67sec 0 299.97sec
soulforge_embers soulforge_embers wild_spirits 328231 13650 46 2.97 749 1497 3.0 14.8 22.8% 0.0% 0.0% 0.0% 120.66sec 13650 299.97sec
soulforge_embers soulforge_embers wild_spirits_proc 328757 365931 1220 39.51 1510 3020 39.5 197.5 22.7% 0.0% 0.0% 0.0% 6.53sec 365931 299.97sec
surging_shots surging_shots aimed_shot 19434 1026600 3422 44.54 3754 7533 44.6 222.7 22.7% 0.0% 0.0% 0.0% 6.69sec 1466395 299.97sec
surging_shots surging_shots aimed_shot_double_tap 19434 111061 370 4.67 3879 7722 0.0 23.4 22.7% 0.0% 0.0% 0.0% 0.00sec 158640 299.97sec
surging_shots surging_shots augmentation 347901 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.97sec
surging_shots surging_shots auto_shot 75 103599 345 20.91 808 1615 104.8 104.6 22.7% 0.0% 0.0% 0.0% 2.88sec 147980 299.97sec
surging_shots surging_shots blood_fury 20572 0 0 0.00 0 0 3.0 0.0 0.0% 0.0% 0.0% 0.0% 120.76sec 0 299.97sec
surging_shots surging_shots double_tap 260402 0 0 0.00 0 0 5.6 0.0 0.0% 0.0% 0.0% 0.0% 60.60sec 0 299.97sec
surging_shots surging_shots dreadfire_vessel 344732 41040 137 0.74 9038 18085 3.7 3.7 21.9% 0.0% 0.0% 0.0% 90.75sec 41040 299.97sec
surging_shots surging_shots eternal_skirmish 323889 11895 40 4.35 446 892 21.8 21.8 22.5% 0.0% 0.0% 0.0% 13.36sec 11895 299.97sec
surging_shots surging_shots flask 307185 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.97sec
surging_shots surging_shots food 308462 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.97sec
surging_shots surging_shots kill_shot 53351 23811 79 0.87 4244 9567 4.4 4.3 23.6% 0.0% 0.0% 0.0% 14.31sec 34011 299.97sec
surging_shots surging_shots master_marksman ticks -269576 152715 509 109.38 279 0 344.2 546.9 0.0% 0.0% 0.0% 0.0% 0.88sec 152715 299.97sec
surging_shots surging_shots multishot 257620 808669 2696 83.31 1583 3167 83.5 416.5 22.6% 0.0% 0.0% 0.0% 3.58sec 1155103 299.97sec
surging_shots surging_shots potion 307159 0 0 0.00 0 0 1.5 0.0 0.0% 0.0% 0.0% 0.0% 309.88sec 0 299.97sec
surging_shots surging_shots rapid_fire ticks -257044 543113 1810 31.64 561 1123 21.8 158.2 22.7% 0.0% 0.0% 0.0% 13.71sec 775783 299.97sec
surging_shots surging_shots shadowcore_oil_blast 336463 13126 44 8.72 245 491 43.6 43.6 22.7% 0.0% 0.0% 0.0% 6.84sec 13126 299.97sec
surging_shots surging_shots steady_shot 56641 95023 317 12.25 1260 2520 60.4 61.3 23.1% 0.0% 0.0% 0.0% 4.94sec 135730 299.97sec
surging_shots surging_shots trueshot 288613 0 0 0.00 0 0 3.0 0.0 0.0% 0.0% 0.0% 0.0% 120.78sec 0 299.97sec
surging_shots surging_shots wild_spirits 328231 14667 49 2.97 807 1616 3.0 14.9 22.3% 0.0% 0.0% 0.0% 120.64sec 14667 299.97sec
surging_shots surging_shots wild_spirits_proc 328757 388293 1294 42.13 1504 3009 42.1 210.6 22.6% 0.0% 0.0% 0.0% 6.13sec 388293 299.97sec
trapping_app trapping_app aimed_shot 19434 1103450 3679 47.51 3784 7578 47.6 237.5 22.7% 0.0% 0.0% 0.0% 6.27sec 1576168 299.97sec
trapping_app trapping_app aimed_shot_double_tap 19434 109000 363 4.56 3893 7758 0.0 22.8 22.9% 0.0% 0.0% 0.0% 0.00sec 155696 299.97sec
trapping_app trapping_app augmentation 347901 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.97sec
trapping_app trapping_app auto_shot 75 111986 373 22.48 811 1623 112.7 112.4 22.8% 0.0% 0.0% 0.0% 2.67sec 159960 299.97sec
trapping_app trapping_app blood_fury 20572 0 0 0.00 0 0 3.0 0.0 0.0% 0.0% 0.0% 0.0% 120.81sec 0 299.97sec
trapping_app trapping_app double_tap 260402 0 0 0.00 0 0 5.6 0.0 0.0% 0.0% 0.0% 0.0% 60.62sec 0 299.97sec
trapping_app trapping_app dreadfire_vessel 344732 41307 138 0.74 9048 18093 3.7 3.7 22.6% 0.0% 0.0% 0.0% 90.74sec 41307 299.97sec
trapping_app trapping_app eternal_skirmish 323889 11880 40 4.35 446 892 21.7 21.7 22.6% 0.0% 0.0% 0.0% 13.49sec 11880 299.97sec
trapping_app trapping_app flask 307185 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.97sec
trapping_app trapping_app food 308462 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.97sec
trapping_app trapping_app kill_shot 53351 25035 83 0.91 4260 9590 4.6 4.6 22.9% 0.0% 0.0% 0.0% 13.52sec 35759 299.97sec
trapping_app trapping_app master_marksman ticks -269576 145263 484 104.16 279 0 304.6 520.8 0.0% 0.0% 0.0% 0.0% 1.00sec 145263 299.97sec
trapping_app trapping_app multishot 257620 807434 2692 81.29 1619 3240 81.5 406.4 22.7% 0.0% 0.0% 0.0% 3.66sec 1153338 299.97sec
trapping_app trapping_app potion 307159 0 0 0.00 0 0 1.5 0.0 0.0% 0.0% 0.0% 0.0% 309.73sec 0 299.97sec
trapping_app trapping_app rapid_fire ticks -257044 328063 1094 24.19 444 886 16.4 121.0 22.7% 0.0% 0.0% 0.0% 18.46sec 468606 299.97sec
trapping_app trapping_app shadowcore_oil_blast 336463 13154 44 8.74 245 491 43.7 43.7 22.7% 0.0% 0.0% 0.0% 6.89sec 13154 299.97sec
trapping_app trapping_app steady_shot 56641 104693 349 13.50 1266 2531 66.6 67.5 22.6% 0.0% 0.0% 0.0% 4.48sec 149543 299.97sec
trapping_app trapping_app trueshot 288613 0 0 0.00 0 0 3.0 0.0 0.0% 0.0% 0.0% 0.0% 120.84sec 0 299.97sec
trapping_app trapping_app wild_spirits 328231 14741 49 2.97 807 1615 3.0 14.8 23.1% 0.0% 0.0% 0.0% 120.70sec 14741 299.97sec
trapping_app trapping_app wild_spirits_proc 328757 402889 1343 43.70 1504 3007 43.7 218.5 22.6% 0.0% 0.0% 0.0% 5.90sec 402889 299.97sec

Fluffy_Pillow : 0 dps, 0 dps to main target

Results, Spec and Gear

RPS Out RPS In Primary Resource Waiting APM Active Skill
31143.7 0.0 Health 0.00% 0.0 100.0% 100%
Talents
  • 15: None
  • 25: None
  • 30: None
  • 35: None
  • 40: None
  • 45: None
  • 50: None
  • Talent Calculator

Charts

Abilities

Buffs

Dynamic Buffs Start Refresh Interval Trigger Avg Dur Up-Time Benefit Overflow Expiry
Health Decade (0 - 10) 0.8 0.0 0.0sec 0.0sec 52.6sec 12.33% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (0 - 10)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 148.7s

Stack Uptimes

  • Health Decade (0 - 10)_1:12.40%
Health Decade (10 - 20) 0.9 0.0 0.0sec 0.0sec 29.9sec 9.05% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (10 - 20)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:0.2s / 47.3s

Stack Uptimes

  • Health Decade (10 - 20)_1:9.06%
Health Decade (20 - 30) 1.0 0.0 0.0sec 0.0sec 33.2sec 11.06% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (20 - 30)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 45.3s

Stack Uptimes

  • Health Decade (20 - 30)_1:11.06%
Health Decade (30 - 40) 1.0 0.0 0.0sec 0.0sec 37.2sec 12.54% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (30 - 40)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:18.4s / 51.1s

Stack Uptimes

  • Health Decade (30 - 40)_1:12.54%
Health Decade (40 - 50) 1.0 0.0 0.0sec 0.0sec 33.7sec 11.38% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (40 - 50)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:21.3s / 47.6s

Stack Uptimes

  • Health Decade (40 - 50)_1:11.38%
Health Decade (50 - 60) 1.0 0.0 0.0sec 0.0sec 32.4sec 10.98% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (50 - 60)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:23.3s / 40.2s

Stack Uptimes

  • Health Decade (50 - 60)_1:10.98%
Health Decade (60 - 70) 1.0 0.0 0.0sec 0.0sec 34.8sec 11.81% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (60 - 70)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:23.6s / 46.3s

Stack Uptimes

  • Health Decade (60 - 70)_1:11.81%
Health Decade (70 - 80) 1.0 0.0 0.0sec 0.0sec 31.4sec 10.61% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (70 - 80)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:18.3s / 45.8s

Stack Uptimes

  • Health Decade (70 - 80)_1:10.61%
Health Decade (80 - 90) 1.0 0.0 0.0sec 0.0sec 17.9sec 6.04% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (80 - 90)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:10.2s / 28.9s

Stack Uptimes

  • Health Decade (80 - 90)_1:6.04%
Health Decade (90 - 100) 1.0 0.0 0.0sec 0.0sec 16.2sec 4.20% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (90 - 100)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:9.1s / 300.0s

Stack Uptimes

  • Health Decade (90 - 100)_1:4.20%
Sinful Revelation 6.7 1.6 40.1sec 31.3sec 11.1sec 24.90% 0.00% 1.6 (1.6) 6.5

Buff Details

  • buff initial source:marksmanship
  • cooldown name:buff_sinful_revelation
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.06
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:10.0s / 308.5s
  • trigger_min/max:0.1s / 305.5s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 48.5s

Stack Uptimes

  • sinful_revelation_1:24.90%

Spelldata

  • id:324260
  • name:Sinful Revelation
  • tooltip:Increase damage taken by $w1% from aura caster.
  • description:
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Sinful Revelation 6.5 1.7 41.6sec 32.0sec 11.2sec 24.21% 0.00% 1.7 (1.7) 6.2

Buff Details

  • buff initial source:eagle_true_focus
  • cooldown name:buff_sinful_revelation
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.06
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:10.0s / 236.6s
  • trigger_min/max:0.0s / 236.6s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 39.1s

Stack Uptimes

  • sinful_revelation_1:24.21%

Spelldata

  • id:324260
  • name:Sinful Revelation
  • tooltip:Increase damage taken by $w1% from aura caster.
  • description:
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Sinful Revelation 6.1 1.2 43.9sec 35.5sec 10.8sec 21.97% 0.00% 1.2 (1.2) 5.8

Buff Details

  • buff initial source:secrets_ot_unblinking_vigil
  • cooldown name:buff_sinful_revelation
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.06
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:10.0s / 251.1s
  • trigger_min/max:0.1s / 251.1s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 41.7s

Stack Uptimes

  • sinful_revelation_1:21.97%

Spelldata

  • id:324260
  • name:Sinful Revelation
  • tooltip:Increase damage taken by $w1% from aura caster.
  • description:
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Sinful Revelation 6.7 1.7 40.5sec 31.3sec 11.2sec 24.79% 0.00% 1.7 (1.7) 6.4

Buff Details

  • buff initial source:surging_shots
  • cooldown name:buff_sinful_revelation
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.06
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:10.0s / 250.6s
  • trigger_min/max:0.2s / 250.6s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 49.7s

Stack Uptimes

  • sinful_revelation_1:24.79%

Spelldata

  • id:324260
  • name:Sinful Revelation
  • tooltip:Increase damage taken by $w1% from aura caster.
  • description:
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Sinful Revelation 6.5 1.5 41.2sec 32.8sec 11.0sec 23.92% 0.00% 1.5 (1.5) 6.3

Buff Details

  • buff initial source:serpentstalkers_trickery
  • cooldown name:buff_sinful_revelation
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.06
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:10.0s / 248.9s
  • trigger_min/max:0.1s / 247.8s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 50.8s

Stack Uptimes

  • sinful_revelation_1:23.92%

Spelldata

  • id:324260
  • name:Sinful Revelation
  • tooltip:Increase damage taken by $w1% from aura caster.
  • description:
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Sinful Revelation 6.8 1.7 39.7sec 30.8sec 11.1sec 25.34% 0.00% 1.7 (1.7) 6.5

Buff Details

  • buff initial source:call_ot_wild
  • cooldown name:buff_sinful_revelation
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.06
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:10.0s / 252.3s
  • trigger_min/max:0.1s / 244.1s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 44.7s

Stack Uptimes

  • sinful_revelation_1:25.34%

Spelldata

  • id:324260
  • name:Sinful Revelation
  • tooltip:Increase damage taken by $w1% from aura caster.
  • description:
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Sinful Revelation 6.9 1.8 39.4sec 30.4sec 11.2sec 25.73% 0.00% 1.8 (1.8) 6.6

Buff Details

  • buff initial source:trapping_app
  • cooldown name:buff_sinful_revelation
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.06
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:10.0s / 243.5s
  • trigger_min/max:0.2s / 241.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 43.0s

Stack Uptimes

  • sinful_revelation_1:25.73%

Spelldata

  • id:324260
  • name:Sinful Revelation
  • tooltip:Increase damage taken by $w1% from aura caster.
  • description:
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Sinful Revelation 6.5 1.5 41.5sec 32.7sec 11.0sec 23.86% 0.00% 1.5 (1.5) 6.2

Buff Details

  • buff initial source:soulforge_embers
  • cooldown name:buff_sinful_revelation
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.06
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:10.0s / 242.6s
  • trigger_min/max:0.1s / 242.6s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 37.1s

Stack Uptimes

  • sinful_revelation_1:23.86%

Spelldata

  • id:324260
  • name:Sinful Revelation
  • tooltip:Increase damage taken by $w1% from aura caster.
  • description:
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Sinful Revelation 7.0 1.8 39.1sec 30.2sec 11.2sec 26.08% 0.00% 1.8 (1.8) 6.7

Buff Details

  • buff initial source:no_lego
  • cooldown name:buff_sinful_revelation
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.06
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:10.0s / 243.6s
  • trigger_min/max:0.2s / 243.6s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 38.6s

Stack Uptimes

  • sinful_revelation_1:26.08%

Spelldata

  • id:324260
  • name:Sinful Revelation
  • tooltip:Increase damage taken by $w1% from aura caster.
  • description:
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
Arcane Intellect

Buff Details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff Details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:15.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
bleeding

Buff Details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_bleeding
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00
Chaos Brand

Buff Details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_chaos_brand
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:5.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1490
  • name:Chaos Brand
  • tooltip:Magic damage taken increased by $s1%.
  • description:{$@spelldesc255260=Your damage brands the target, increasing magic damage taken by $1490s1%.}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Mortal Wounds

Buff Details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_mortal_wounds
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.50
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:115804
  • name:Mortal Wounds
  • tooltip:Healing effects received reduced by $w1%.
  • description:Grievously wounds the target, reducing the effectiveness of any healing received for {$115804d=10 seconds}.
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%
Mystic Touch

Buff Details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_mystic_touch
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:5.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:113746
  • name:Mystic Touch
  • tooltip:Physical damage taken increased by $w1%.
  • description:{$@spelldesc8647=Your damage weakens the target, increasing Physical damage taken by $113746s1%.}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Power Word: Fortitude

Buff Details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.$?$w2>0[ Magic damage taken reduced by $w2%.][]
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Resources

Change Start Gain/s Loss/s Overflow (Total) End (Avg) Min Max

Statistics & Data Analysis

Fight Length
Fluffy_Pillow Fight Length
Count 1217
Mean 299.97
Minimum 240.10
Maximum 359.83
Spread ( max - min ) 119.74
Range [ ( max - min ) / 2 * 100% ] 19.96%
DPS
Fluffy_Pillow Damage Per Second
Count 1217
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Priority Target DPS
Fluffy_Pillow Priority Target Damage Per Second
Count 1217
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
DPS(e)
Fluffy_Pillow Damage Per Second (Effective)
Count 1217
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Damage
Fluffy_Pillow Damage
Count 1217
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
DTPS
Fluffy_Pillow Damage Taken Per Second
Count 1217
Mean 33273.81
Minimum 31582.22
Maximum 34832.51
Spread ( max - min ) 3250.29
Range [ ( max - min ) / 2 * 100% ] 4.88%
Standard Deviation 593.4191
5th Percentile 32293.28
95th Percentile 34247.22
( 95th Percentile - 5th Percentile ) 1953.94
Mean Distribution
Standard Deviation 17.0105
95.00% Confidence Interval ( 33240.47 - 33307.15 )
Normalized 95.00% Confidence Interval ( 99.90% - 100.10% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 13
0.1% Error 1222
0.1 Scale Factor Error with Delta=300 3007
0.05 Scale Factor Error with Delta=300 12025
0.01 Scale Factor Error with Delta=300 300613
HPS
Fluffy_Pillow Healing Per Second
Count 1217
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS(e)
Fluffy_Pillow Healing Per Second (Effective)
Count 1217
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Fluffy_Pillow Heal
Count 1217
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Fluffy_Pillow Healing Taken Per Second
Count 1217
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Fluffy_Pillow Theck-Meloree Index
Count 1217
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Fluffy_PillowTheck-Meloree Index (Effective)
Count 1217
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
Fluffy_Pillow Max Spike Value
Count 123
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 snapshot_stats

Stats

Level Bonus (63) Race Bonus (humanoid) Raid-Buffed Unbuffed Gear Amount
Strength 0 0 0 0 0
Agility 0 0 0 0 0
Stamina 0 0 0 0 0
Intellect 0 0 0 0 0
Spirit 0 0 0 0 0
Health 0 11707076 0
Melee Crit 5.00% 5.00% 0
Spell Crit 0.00% 0.00% 0
Haste 0.00% 0.00% 0
Versatility 0.00% 0.00% 0
Mitigation Versatility 0.00% 0.00% 0
Mastery 0.00% 0.00% 0
Armor 1071 1071 1071
Run Speed 7 0 0
Tank-Miss 3.00% 3.00% 0
Tank-Dodge 3.00% 3.00% 0
Tank-Parry 3.00% 3.00% 0
Tank-Block 3.00% 3.00% 0
Tank-Crit 0.00% 0.00% 0

Gear

Source Slot Average Item Level: 0.00

Talents

Level
15 none none none
30 none none none
45 none none none
60 none none none
75 none none none
90 none none none
100 none none none

Profile

enemy="Fluffy_Pillow"
source=default
spec=unknown
level=63
race=humanoid
role=tank
position=front
talents=0000000

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=snapshot_stats

# Executed every time the actor is available.


# Gear Summary
# gear_ilvl=0.00

enemy2 : 0 dps, 0 dps to main target

Results, Spec and Gear

RPS Out RPS In Primary Resource Waiting APM Active Skill
16003.2 0.0 Health 0.00% 0.0 100.0% 100%
Talents
  • 15: None
  • 25: None
  • 30: None
  • 35: None
  • 40: None
  • 45: None
  • 50: None
  • Talent Calculator

Charts

Abilities

Buffs

Dynamic Buffs Start Refresh Interval Trigger Avg Dur Up-Time Benefit Overflow Expiry
Health Decade (0 - 10) 0.7 0.0 0.0sec 0.0sec 57.4sec 12.96% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:enemy2
  • cooldown name:buff_Health Decade (0 - 10)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 156.8s

Stack Uptimes

  • Health Decade (0 - 10)_1:13.01%
Health Decade (10 - 20) 0.9 0.0 0.0sec 0.0sec 32.0sec 9.68% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:enemy2
  • cooldown name:buff_Health Decade (10 - 20)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:0.3s / 57.6s

Stack Uptimes

  • Health Decade (10 - 20)_1:9.69%
Health Decade (20 - 30) 1.0 0.0 0.0sec 0.0sec 34.9sec 11.70% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:enemy2
  • cooldown name:buff_Health Decade (20 - 30)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:1.5s / 50.2s

Stack Uptimes

  • Health Decade (20 - 30)_1:11.70%
Health Decade (30 - 40) 1.0 0.0 0.0sec 0.0sec 38.3sec 12.98% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:enemy2
  • cooldown name:buff_Health Decade (30 - 40)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:13.8s / 58.5s

Stack Uptimes

  • Health Decade (30 - 40)_1:12.98%
Health Decade (40 - 50) 1.0 0.0 0.0sec 0.0sec 32.0sec 10.81% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:enemy2
  • cooldown name:buff_Health Decade (40 - 50)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:15.4s / 57.2s

Stack Uptimes

  • Health Decade (40 - 50)_1:10.81%
Health Decade (50 - 60) 1.0 0.0 0.0sec 0.0sec 32.6sec 11.04% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:enemy2
  • cooldown name:buff_Health Decade (50 - 60)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:21.8s / 43.4s

Stack Uptimes

  • Health Decade (50 - 60)_1:11.04%
Health Decade (60 - 70) 1.0 0.0 0.0sec 0.0sec 37.5sec 12.70% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:enemy2
  • cooldown name:buff_Health Decade (60 - 70)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:22.9s / 54.9s

Stack Uptimes

  • Health Decade (60 - 70)_1:12.70%
Health Decade (70 - 80) 1.0 0.0 0.0sec 0.0sec 29.4sec 9.94% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:enemy2
  • cooldown name:buff_Health Decade (70 - 80)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:13.6s / 47.0s

Stack Uptimes

  • Health Decade (70 - 80)_1:9.94%
Health Decade (80 - 90) 1.0 0.0 0.0sec 0.0sec 13.1sec 4.43% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:enemy2
  • cooldown name:buff_Health Decade (80 - 90)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:7.4s / 22.5s

Stack Uptimes

  • Health Decade (80 - 90)_1:4.43%
Health Decade (90 - 100) 1.0 0.0 0.0sec 0.0sec 14.9sec 3.78% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:enemy2
  • cooldown name:buff_Health Decade (90 - 100)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:8.7s / 300.0s

Stack Uptimes

  • Health Decade (90 - 100)_1:3.78%
Sinful Revelation 0.3 0.0 92.5sec 85.7sec 10.0sec 1.10% 0.00% 0.0 (0.0) 0.3

Buff Details

  • buff initial source:marksmanship
  • cooldown name:buff_sinful_revelation
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.06
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:16.4s / 261.6s
  • trigger_min/max:2.4s / 261.6s
  • trigger_pct:100.00%
  • duration_min/max:1.8s / 19.7s

Stack Uptimes

  • sinful_revelation_1:1.14%

Spelldata

  • id:324260
  • name:Sinful Revelation
  • tooltip:Increase damage taken by $w1% from aura caster.
  • description:
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Sinful Revelation 0.3 0.0 103.1sec 90.6sec 9.9sec 0.99% 0.00% 0.0 (0.0) 0.3

Buff Details

  • buff initial source:serpentstalkers_trickery
  • cooldown name:buff_sinful_revelation
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.06
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:10.9s / 253.7s
  • trigger_min/max:2.4s / 253.7s
  • trigger_pct:100.00%
  • duration_min/max:0.3s / 19.5s

Stack Uptimes

  • sinful_revelation_1:1.02%

Spelldata

  • id:324260
  • name:Sinful Revelation
  • tooltip:Increase damage taken by $w1% from aura caster.
  • description:
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
Arcane Intellect

Buff Details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff Details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:15.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
bleeding

Buff Details

  • buff initial source:enemy2
  • cooldown name:buff_bleeding
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00
Chaos Brand

Buff Details

  • buff initial source:enemy2
  • cooldown name:buff_chaos_brand
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:5.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1490
  • name:Chaos Brand
  • tooltip:Magic damage taken increased by $s1%.
  • description:{$@spelldesc255260=Your damage brands the target, increasing magic damage taken by $1490s1%.}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Mortal Wounds

Buff Details

  • buff initial source:enemy2
  • cooldown name:buff_mortal_wounds
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.50
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:115804
  • name:Mortal Wounds
  • tooltip:Healing effects received reduced by $w1%.
  • description:Grievously wounds the target, reducing the effectiveness of any healing received for {$115804d=10 seconds}.
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%
Mystic Touch

Buff Details

  • buff initial source:enemy2
  • cooldown name:buff_mystic_touch
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:5.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:113746
  • name:Mystic Touch
  • tooltip:Physical damage taken increased by $w1%.
  • description:{$@spelldesc8647=Your damage weakens the target, increasing Physical damage taken by $113746s1%.}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Power Word: Fortitude

Buff Details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.$?$w2>0[ Magic damage taken reduced by $w2%.][]
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Resources

Change Start Gain/s Loss/s Overflow (Total) End (Avg) Min Max

Statistics & Data Analysis

Fight Length
enemy2 Fight Length
Count 1217
Mean 299.97
Minimum 240.10
Maximum 359.83
Spread ( max - min ) 119.74
Range [ ( max - min ) / 2 * 100% ] 19.96%
DPS
enemy2 Damage Per Second
Count 1217
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Priority Target DPS
enemy2 Priority Target Damage Per Second
Count 1217
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
DPS(e)
enemy2 Damage Per Second (Effective)
Count 1217
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Damage
enemy2 Damage
Count 1217
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
DTPS
enemy2 Damage Taken Per Second
Count 1217
Mean 17030.84
Minimum 15777.60
Maximum 18155.87
Spread ( max - min ) 2378.27
Range [ ( max - min ) / 2 * 100% ] 6.98%
Standard Deviation 435.3798
5th Percentile 16353.70
95th Percentile 17769.00
( 95th Percentile - 5th Percentile ) 1415.30
Mean Distribution
Standard Deviation 12.4802
95.00% Confidence Interval ( 17006.37 - 17055.30 )
Normalized 95.00% Confidence Interval ( 99.86% - 100.14% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 26
0.1% Error 2511
0.1 Scale Factor Error with Delta=300 1619
0.05 Scale Factor Error with Delta=300 6473
0.01 Scale Factor Error with Delta=300 161816
HPS
enemy2 Healing Per Second
Count 1217
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS(e)
enemy2 Healing Per Second (Effective)
Count 1217
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
enemy2 Heal
Count 1217
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
enemy2 Healing Taken Per Second
Count 1217
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
enemy2 Theck-Meloree Index
Count 1217
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
enemy2Theck-Meloree Index (Effective)
Count 1217
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
enemy2 Max Spike Value
Count 123
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 snapshot_stats

Stats

Level Bonus (63) Race Bonus (humanoid) Raid-Buffed Unbuffed Gear Amount
Strength 0 0 0 0 0
Agility 0 0 0 0 0
Stamina 0 0 0 0 0
Intellect 0 0 0 0 0
Spirit 0 0 0 0 0
Health 0 5938187 0
Melee Crit 5.00% 5.00% 0
Spell Crit 0.00% 0.00% 0
Haste 0.00% 0.00% 0
Versatility 0.00% 0.00% 0
Mitigation Versatility 0.00% 0.00% 0
Mastery 0.00% 0.00% 0
Armor 1071 1071 1071
Run Speed 7 0 0
Tank-Miss 3.00% 3.00% 0
Tank-Dodge 3.00% 3.00% 0
Tank-Parry 3.00% 3.00% 0
Tank-Block 3.00% 3.00% 0
Tank-Crit 0.00% 0.00% 0

Gear

Source Slot Average Item Level: 0.00

Talents

Level
15 none none none
30 none none none
45 none none none
60 none none none
75 none none none
90 none none none
100 none none none

Profile

enemy="enemy2"
source=default
spec=unknown
level=63
race=humanoid
role=tank
position=front
talents=0000000

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=snapshot_stats

# Executed every time the actor is available.


# Gear Summary
# gear_ilvl=0.00

enemy3 : 0 dps, 0 dps to main target

Results, Spec and Gear

RPS Out RPS In Primary Resource Waiting APM Active Skill
15816.5 0.0 Health 0.00% 0.0 100.0% 100%
Talents
  • 15: None
  • 25: None
  • 30: None
  • 35: None
  • 40: None
  • 45: None
  • 50: None
  • Talent Calculator

Charts

Abilities

Buffs

Dynamic Buffs Start Refresh Interval Trigger Avg Dur Up-Time Benefit Overflow Expiry
Health Decade (0 - 10) 0.7 0.0 0.0sec 0.0sec 57.7sec 13.38% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:enemy3
  • cooldown name:buff_Health Decade (0 - 10)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 160.2s

Stack Uptimes

  • Health Decade (0 - 10)_1:13.45%
Health Decade (10 - 20) 0.9 0.0 0.0sec 0.0sec 32.0sec 9.56% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:enemy3
  • cooldown name:buff_Health Decade (10 - 20)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 57.8s

Stack Uptimes

  • Health Decade (10 - 20)_1:9.57%
Health Decade (20 - 30) 1.0 0.0 0.0sec 0.0sec 35.1sec 11.60% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:enemy3
  • cooldown name:buff_Health Decade (20 - 30)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:0.2s / 50.8s

Stack Uptimes

  • Health Decade (20 - 30)_1:11.60%
Health Decade (30 - 40) 1.0 0.0 0.0sec 0.0sec 38.0sec 12.86% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:enemy3
  • cooldown name:buff_Health Decade (30 - 40)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:12.5s / 57.5s

Stack Uptimes

  • Health Decade (30 - 40)_1:12.86%
Health Decade (40 - 50) 1.0 0.0 0.0sec 0.0sec 31.3sec 10.59% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:enemy3
  • cooldown name:buff_Health Decade (40 - 50)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:15.5s / 54.9s

Stack Uptimes

  • Health Decade (40 - 50)_1:10.59%
Health Decade (50 - 60) 1.0 0.0 0.0sec 0.0sec 32.4sec 10.98% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:enemy3
  • cooldown name:buff_Health Decade (50 - 60)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:21.3s / 43.0s

Stack Uptimes

  • Health Decade (50 - 60)_1:10.98%
Health Decade (60 - 70) 1.0 0.0 0.0sec 0.0sec 37.5sec 12.71% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:enemy3
  • cooldown name:buff_Health Decade (60 - 70)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:23.8s / 52.8s

Stack Uptimes

  • Health Decade (60 - 70)_1:12.71%
Health Decade (70 - 80) 1.0 0.0 0.0sec 0.0sec 29.5sec 9.98% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:enemy3
  • cooldown name:buff_Health Decade (70 - 80)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:14.7s / 45.2s

Stack Uptimes

  • Health Decade (70 - 80)_1:9.98%
Health Decade (80 - 90) 1.0 0.0 0.0sec 0.0sec 13.3sec 4.49% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:enemy3
  • cooldown name:buff_Health Decade (80 - 90)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:7.6s / 24.1s

Stack Uptimes

  • Health Decade (80 - 90)_1:4.49%
Health Decade (90 - 100) 1.0 0.0 0.0sec 0.0sec 15.2sec 3.87% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:enemy3
  • cooldown name:buff_Health Decade (90 - 100)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:8.6s / 300.0s

Stack Uptimes

  • Health Decade (90 - 100)_1:3.87%
Sinful Revelation 0.3 0.0 105.1sec 92.9sec 10.0sec 1.03% 0.00% 0.0 (0.0) 0.3

Buff Details

  • buff initial source:marksmanship
  • cooldown name:buff_sinful_revelation
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.06
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:12.4s / 238.2s
  • trigger_min/max:2.4s / 238.2s
  • trigger_pct:100.00%
  • duration_min/max:1.4s / 19.5s

Stack Uptimes

  • sinful_revelation_1:1.05%

Spelldata

  • id:324260
  • name:Sinful Revelation
  • tooltip:Increase damage taken by $w1% from aura caster.
  • description:
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Sinful Revelation 0.3 0.0 109.8sec 99.4sec 9.9sec 1.06% 0.00% 0.0 (0.0) 0.3

Buff Details

  • buff initial source:serpentstalkers_trickery
  • cooldown name:buff_sinful_revelation
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.06
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:14.6s / 311.7s
  • trigger_min/max:4.7s / 311.7s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 19.6s

Stack Uptimes

  • sinful_revelation_1:1.10%

Spelldata

  • id:324260
  • name:Sinful Revelation
  • tooltip:Increase damage taken by $w1% from aura caster.
  • description:
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
Arcane Intellect

Buff Details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff Details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:15.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
bleeding

Buff Details

  • buff initial source:enemy3
  • cooldown name:buff_bleeding
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00
Chaos Brand

Buff Details

  • buff initial source:enemy3
  • cooldown name:buff_chaos_brand
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:5.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1490
  • name:Chaos Brand
  • tooltip:Magic damage taken increased by $s1%.
  • description:{$@spelldesc255260=Your damage brands the target, increasing magic damage taken by $1490s1%.}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Mortal Wounds

Buff Details

  • buff initial source:enemy3
  • cooldown name:buff_mortal_wounds
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.50
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:115804
  • name:Mortal Wounds
  • tooltip:Healing effects received reduced by $w1%.
  • description:Grievously wounds the target, reducing the effectiveness of any healing received for {$115804d=10 seconds}.
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%
Mystic Touch

Buff Details

  • buff initial source:enemy3
  • cooldown name:buff_mystic_touch
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:5.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:113746
  • name:Mystic Touch
  • tooltip:Physical damage taken increased by $w1%.
  • description:{$@spelldesc8647=Your damage weakens the target, increasing Physical damage taken by $113746s1%.}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Power Word: Fortitude

Buff Details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.$?$w2>0[ Magic damage taken reduced by $w2%.][]
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Resources

Change Start Gain/s Loss/s Overflow (Total) End (Avg) Min Max

Statistics & Data Analysis

Fight Length
enemy3 Fight Length
Count 1217
Mean 299.97
Minimum 240.10
Maximum 359.83
Spread ( max - min ) 119.74
Range [ ( max - min ) / 2 * 100% ] 19.96%
DPS
enemy3 Damage Per Second
Count 1217
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Priority Target DPS
enemy3 Priority Target Damage Per Second
Count 1217
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
DPS(e)
enemy3 Damage Per Second (Effective)
Count 1217
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Damage
enemy3 Damage
Count 1217
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
DTPS
enemy3 Damage Taken Per Second
Count 1217
Mean 16886.38
Minimum 15843.27
Maximum 18036.82
Spread ( max - min ) 2193.55
Range [ ( max - min ) / 2 * 100% ] 6.50%
Standard Deviation 429.7211
5th Percentile 16194.30
95th Percentile 17594.62
( 95th Percentile - 5th Percentile ) 1400.32
Mean Distribution
Standard Deviation 12.3180
95.00% Confidence Interval ( 16862.24 - 16910.53 )
Normalized 95.00% Confidence Interval ( 99.86% - 100.14% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 25
0.1% Error 2488
0.1 Scale Factor Error with Delta=300 1577
0.05 Scale Factor Error with Delta=300 6306
0.01 Scale Factor Error with Delta=300 157637
HPS
enemy3 Healing Per Second
Count 1217
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS(e)
enemy3 Healing Per Second (Effective)
Count 1217
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
enemy3 Heal
Count 1217
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
enemy3 Healing Taken Per Second
Count 1217
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
enemy3 Theck-Meloree Index
Count 1217
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
enemy3Theck-Meloree Index (Effective)
Count 1217
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
enemy3 Max Spike Value
Count 123
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 snapshot_stats

Stats

Level Bonus (63) Race Bonus (humanoid) Raid-Buffed Unbuffed Gear Amount
Strength 0 0 0 0 0
Agility 0 0 0 0 0
Stamina 0 0 0 0 0
Intellect 0 0 0 0 0
Spirit 0 0 0 0 0
Health 0 5968203 0
Melee Crit 5.00% 5.00% 0
Spell Crit 0.00% 0.00% 0
Haste 0.00% 0.00% 0
Versatility 0.00% 0.00% 0
Mitigation Versatility 0.00% 0.00% 0
Mastery 0.00% 0.00% 0
Armor 1071 1071 1071
Run Speed 7 0 0
Tank-Miss 3.00% 3.00% 0
Tank-Dodge 3.00% 3.00% 0
Tank-Parry 3.00% 3.00% 0
Tank-Block 3.00% 3.00% 0
Tank-Crit 0.00% 0.00% 0

Gear

Source Slot Average Item Level: 0.00

Talents

Level
15 none none none
30 none none none
45 none none none
60 none none none
75 none none none
90 none none none
100 none none none

Profile

enemy="enemy3"
source=default
spec=unknown
level=63
race=humanoid
role=tank
position=front
talents=0000000

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=snapshot_stats

# Executed every time the actor is available.


# Gear Summary
# gear_ilvl=0.00

enemy4 : 0 dps, 0 dps to main target

Results, Spec and Gear

RPS Out RPS In Primary Resource Waiting APM Active Skill
15574.5 0.0 Health 0.00% 0.0 100.0% 100%
Talents
  • 15: None
  • 25: None
  • 30: None
  • 35: None
  • 40: None
  • 45: None
  • 50: None
  • Talent Calculator

Charts

Abilities

Buffs

Dynamic Buffs Start Refresh Interval Trigger Avg Dur Up-Time Benefit Overflow Expiry
Health Decade (0 - 10) 0.8 0.0 0.0sec 0.0sec 59.6sec 13.98% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:enemy4
  • cooldown name:buff_Health Decade (0 - 10)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 156.0s

Stack Uptimes

  • Health Decade (0 - 10)_1:14.09%
Health Decade (10 - 20) 0.9 0.0 0.0sec 0.0sec 32.2sec 9.72% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:enemy4
  • cooldown name:buff_Health Decade (10 - 20)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 59.6s

Stack Uptimes

  • Health Decade (10 - 20)_1:9.72%
Health Decade (20 - 30) 1.0 0.0 0.0sec 0.0sec 36.1sec 11.98% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:enemy4
  • cooldown name:buff_Health Decade (20 - 30)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 52.4s

Stack Uptimes

  • Health Decade (20 - 30)_1:11.98%
Health Decade (30 - 40) 1.0 0.0 0.0sec 0.0sec 37.1sec 12.55% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:enemy4
  • cooldown name:buff_Health Decade (30 - 40)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:13.4s / 57.8s

Stack Uptimes

  • Health Decade (30 - 40)_1:12.55%
Health Decade (40 - 50) 1.0 0.0 0.0sec 0.0sec 30.6sec 10.36% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:enemy4
  • cooldown name:buff_Health Decade (40 - 50)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:15.9s / 56.8s

Stack Uptimes

  • Health Decade (40 - 50)_1:10.36%
Health Decade (50 - 60) 1.0 0.0 0.0sec 0.0sec 33.4sec 11.30% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:enemy4
  • cooldown name:buff_Health Decade (50 - 60)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:21.2s / 46.3s

Stack Uptimes

  • Health Decade (50 - 60)_1:11.30%
Health Decade (60 - 70) 1.0 0.0 0.0sec 0.0sec 37.1sec 12.57% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:enemy4
  • cooldown name:buff_Health Decade (60 - 70)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:23.2s / 54.2s

Stack Uptimes

  • Health Decade (60 - 70)_1:12.57%
Health Decade (70 - 80) 1.0 0.0 0.0sec 0.0sec 28.2sec 9.52% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:enemy4
  • cooldown name:buff_Health Decade (70 - 80)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:13.5s / 45.6s

Stack Uptimes

  • Health Decade (70 - 80)_1:9.52%
Health Decade (80 - 90) 1.0 0.0 0.0sec 0.0sec 12.4sec 4.19% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:enemy4
  • cooldown name:buff_Health Decade (80 - 90)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:7.5s / 24.5s

Stack Uptimes

  • Health Decade (80 - 90)_1:4.19%
Health Decade (90 - 100) 1.0 0.0 0.0sec 0.0sec 15.1sec 3.83% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:enemy4
  • cooldown name:buff_Health Decade (90 - 100)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:8.7s / 300.0s

Stack Uptimes

  • Health Decade (90 - 100)_1:3.83%
Sinful Revelation 0.3 0.0 95.8sec 83.4sec 9.9sec 1.14% 0.00% 0.0 (0.0) 0.3

Buff Details

  • buff initial source:marksmanship
  • cooldown name:buff_sinful_revelation
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.06
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:12.4s / 247.3s
  • trigger_min/max:1.5s / 247.3s
  • trigger_pct:100.00%
  • duration_min/max:0.5s / 17.8s

Stack Uptimes

  • sinful_revelation_1:1.17%

Spelldata

  • id:324260
  • name:Sinful Revelation
  • tooltip:Increase damage taken by $w1% from aura caster.
  • description:
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Sinful Revelation 0.5 0.0 96.6sec 80.6sec 10.2sec 1.82% 0.00% 0.0 (0.0) 0.5

Buff Details

  • buff initial source:serpentstalkers_trickery
  • cooldown name:buff_sinful_revelation
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.06
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:10.1s / 280.9s
  • trigger_min/max:1.5s / 280.9s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 24.4s

Stack Uptimes

  • sinful_revelation_1:1.83%

Spelldata

  • id:324260
  • name:Sinful Revelation
  • tooltip:Increase damage taken by $w1% from aura caster.
  • description:
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
Arcane Intellect

Buff Details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff Details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:15.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
bleeding

Buff Details

  • buff initial source:enemy4
  • cooldown name:buff_bleeding
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00
Chaos Brand

Buff Details

  • buff initial source:enemy4
  • cooldown name:buff_chaos_brand
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:5.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1490
  • name:Chaos Brand
  • tooltip:Magic damage taken increased by $s1%.
  • description:{$@spelldesc255260=Your damage brands the target, increasing magic damage taken by $1490s1%.}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Mortal Wounds

Buff Details

  • buff initial source:enemy4
  • cooldown name:buff_mortal_wounds
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.50
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:115804
  • name:Mortal Wounds
  • tooltip:Healing effects received reduced by $w1%.
  • description:Grievously wounds the target, reducing the effectiveness of any healing received for {$115804d=10 seconds}.
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%
Mystic Touch

Buff Details

  • buff initial source:enemy4
  • cooldown name:buff_mystic_touch
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:5.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:113746
  • name:Mystic Touch
  • tooltip:Physical damage taken increased by $w1%.
  • description:{$@spelldesc8647=Your damage weakens the target, increasing Physical damage taken by $113746s1%.}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Power Word: Fortitude

Buff Details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.$?$w2>0[ Magic damage taken reduced by $w2%.][]
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Resources

Change Start Gain/s Loss/s Overflow (Total) End (Avg) Min Max

Statistics & Data Analysis

Fight Length
enemy4 Fight Length
Count 1217
Mean 299.97
Minimum 240.10
Maximum 359.83
Spread ( max - min ) 119.74
Range [ ( max - min ) / 2 * 100% ] 19.96%
DPS
enemy4 Damage Per Second
Count 1217
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Priority Target DPS
enemy4 Priority Target Damage Per Second
Count 1217
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
DPS(e)
enemy4 Damage Per Second (Effective)
Count 1217
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Damage
enemy4 Damage
Count 1217
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
DTPS
enemy4 Damage Taken Per Second
Count 1217
Mean 16684.92
Minimum 15415.02
Maximum 17853.61
Spread ( max - min ) 2438.59
Range [ ( max - min ) / 2 * 100% ] 7.31%
Standard Deviation 436.6287
5th Percentile 15999.39
95th Percentile 17416.70
( 95th Percentile - 5th Percentile ) 1417.32
Mean Distribution
Standard Deviation 12.5160
95.00% Confidence Interval ( 16660.39 - 16709.45 )
Normalized 95.00% Confidence Interval ( 99.85% - 100.15% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 27
0.1% Error 2631
0.1 Scale Factor Error with Delta=300 1628
0.05 Scale Factor Error with Delta=300 6510
0.01 Scale Factor Error with Delta=300 162746
HPS
enemy4 Healing Per Second
Count 1217
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS(e)
enemy4 Healing Per Second (Effective)
Count 1217
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
enemy4 Heal
Count 1217
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
enemy4 Healing Taken Per Second
Count 1217
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
enemy4 Theck-Meloree Index
Count 1217
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
enemy4Theck-Meloree Index (Effective)
Count 1217
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
enemy4 Max Spike Value
Count 123
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 snapshot_stats

Stats

Level Bonus (63) Race Bonus (humanoid) Raid-Buffed Unbuffed Gear Amount
Strength 0 0 0 0 0
Agility 0 0 0 0 0
Stamina 0 0 0 0 0
Intellect 0 0 0 0 0
Spirit 0 0 0 0 0
Health 0 5857107 0
Melee Crit 5.00% 5.00% 0
Spell Crit 0.00% 0.00% 0
Haste 0.00% 0.00% 0
Versatility 0.00% 0.00% 0
Mitigation Versatility 0.00% 0.00% 0
Mastery 0.00% 0.00% 0
Armor 1071 1071 1071
Run Speed 7 0 0
Tank-Miss 3.00% 3.00% 0
Tank-Dodge 3.00% 3.00% 0
Tank-Parry 3.00% 3.00% 0
Tank-Block 3.00% 3.00% 0
Tank-Crit 0.00% 0.00% 0

Gear

Source Slot Average Item Level: 0.00

Talents

Level
15 none none none
30 none none none
45 none none none
60 none none none
75 none none none
90 none none none
100 none none none

Profile

enemy="enemy4"
source=default
spec=unknown
level=63
race=humanoid
role=tank
position=front
talents=0000000

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=snapshot_stats

# Executed every time the actor is available.


# Gear Summary
# gear_ilvl=0.00

enemy5 : 0 dps, 0 dps to main target

Results, Spec and Gear

RPS Out RPS In Primary Resource Waiting APM Active Skill
15875.8 0.0 Health 0.00% 0.0 100.0% 100%
Talents
  • 15: None
  • 25: None
  • 30: None
  • 35: None
  • 40: None
  • 45: None
  • 50: None
  • Talent Calculator

Charts

Abilities

Buffs

Dynamic Buffs Start Refresh Interval Trigger Avg Dur Up-Time Benefit Overflow Expiry
Health Decade (0 - 10) 0.7 0.0 0.0sec 0.0sec 57.7sec 13.40% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:enemy5
  • cooldown name:buff_Health Decade (0 - 10)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:0.2s / 160.4s

Stack Uptimes

  • Health Decade (0 - 10)_1:13.58%
Health Decade (10 - 20) 0.9 0.0 0.0sec 0.0sec 32.6sec 9.94% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:enemy5
  • cooldown name:buff_Health Decade (10 - 20)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:0.3s / 58.0s

Stack Uptimes

  • Health Decade (10 - 20)_1:9.96%
Health Decade (20 - 30) 1.0 0.0 0.0sec 0.0sec 35.3sec 11.76% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:enemy5
  • cooldown name:buff_Health Decade (20 - 30)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 53.0s

Stack Uptimes

  • Health Decade (20 - 30)_1:11.76%
Health Decade (30 - 40) 1.0 0.0 0.0sec 0.0sec 37.7sec 12.73% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:enemy5
  • cooldown name:buff_Health Decade (30 - 40)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:12.9s / 57.2s

Stack Uptimes

  • Health Decade (30 - 40)_1:12.73%
Health Decade (40 - 50) 1.0 0.0 0.0sec 0.0sec 31.1sec 10.50% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:enemy5
  • cooldown name:buff_Health Decade (40 - 50)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:15.9s / 58.1s

Stack Uptimes

  • Health Decade (40 - 50)_1:10.50%
Health Decade (50 - 60) 1.0 0.0 0.0sec 0.0sec 33.1sec 11.20% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:enemy5
  • cooldown name:buff_Health Decade (50 - 60)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:20.7s / 44.8s

Stack Uptimes

  • Health Decade (50 - 60)_1:11.20%
Health Decade (60 - 70) 1.0 0.0 0.0sec 0.0sec 37.6sec 12.74% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:enemy5
  • cooldown name:buff_Health Decade (60 - 70)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:22.3s / 52.6s

Stack Uptimes

  • Health Decade (60 - 70)_1:12.74%
Health Decade (70 - 80) 1.0 0.0 0.0sec 0.0sec 28.4sec 9.59% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:enemy5
  • cooldown name:buff_Health Decade (70 - 80)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:12.4s / 46.5s

Stack Uptimes

  • Health Decade (70 - 80)_1:9.59%
Health Decade (80 - 90) 1.0 0.0 0.0sec 0.0sec 12.6sec 4.27% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:enemy5
  • cooldown name:buff_Health Decade (80 - 90)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:7.6s / 22.2s

Stack Uptimes

  • Health Decade (80 - 90)_1:4.27%
Health Decade (90 - 100) 1.0 0.0 0.0sec 0.0sec 15.1sec 3.85% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:enemy5
  • cooldown name:buff_Health Decade (90 - 100)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:8.7s / 300.0s

Stack Uptimes

  • Health Decade (90 - 100)_1:3.85%
Sinful Revelation 6.0 1.3 44.9sec 36.0sec 10.9sec 21.95% 0.00% 1.3 (1.3) 5.8

Buff Details

  • buff initial source:marksmanship
  • cooldown name:buff_sinful_revelation
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.06
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:10.0s / 265.9s
  • trigger_min/max:0.1s / 265.9s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 40.7s

Stack Uptimes

  • sinful_revelation_1:21.95%

Spelldata

  • id:324260
  • name:Sinful Revelation
  • tooltip:Increase damage taken by $w1% from aura caster.
  • description:
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Sinful Revelation 6.7 1.8 41.4sec 31.7sec 11.2sec 24.93% 0.00% 1.8 (1.8) 6.5

Buff Details

  • buff initial source:eagle_true_focus
  • cooldown name:buff_sinful_revelation
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.06
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:10.0s / 240.6s
  • trigger_min/max:0.0s / 240.6s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 43.5s

Stack Uptimes

  • sinful_revelation_1:24.93%

Spelldata

  • id:324260
  • name:Sinful Revelation
  • tooltip:Increase damage taken by $w1% from aura caster.
  • description:
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Sinful Revelation 7.2 2.0 38.3sec 29.1sec 11.2sec 27.10% 0.00% 2.0 (2.0) 7.0

Buff Details

  • buff initial source:secrets_ot_unblinking_vigil
  • cooldown name:buff_sinful_revelation
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.06
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:10.0s / 218.2s
  • trigger_min/max:0.1s / 218.2s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 57.0s

Stack Uptimes

  • sinful_revelation_1:27.10%

Spelldata

  • id:324260
  • name:Sinful Revelation
  • tooltip:Increase damage taken by $w1% from aura caster.
  • description:
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Sinful Revelation 6.6 1.7 41.8sec 32.2sec 11.1sec 24.22% 0.00% 1.7 (1.7) 6.3

Buff Details

  • buff initial source:surging_shots
  • cooldown name:buff_sinful_revelation
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.06
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:10.0s / 206.7s
  • trigger_min/max:0.0s / 206.7s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 43.2s

Stack Uptimes

  • sinful_revelation_1:24.22%

Spelldata

  • id:324260
  • name:Sinful Revelation
  • tooltip:Increase damage taken by $w1% from aura caster.
  • description:
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Sinful Revelation 6.0 1.3 43.7sec 34.6sec 11.0sec 22.02% 0.00% 1.3 (1.3) 5.8

Buff Details

  • buff initial source:serpentstalkers_trickery
  • cooldown name:buff_sinful_revelation
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.06
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:10.0s / 229.8s
  • trigger_min/max:0.0s / 229.8s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 40.0s

Stack Uptimes

  • sinful_revelation_1:22.02%

Spelldata

  • id:324260
  • name:Sinful Revelation
  • tooltip:Increase damage taken by $w1% from aura caster.
  • description:
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Sinful Revelation 6.5 1.6 42.2sec 32.8sec 11.1sec 23.85% 0.00% 1.6 (1.6) 6.2

Buff Details

  • buff initial source:call_ot_wild
  • cooldown name:buff_sinful_revelation
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.06
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:10.0s / 244.7s
  • trigger_min/max:0.1s / 244.7s
  • trigger_pct:100.00%
  • duration_min/max:0.2s / 42.7s

Stack Uptimes

  • sinful_revelation_1:23.85%

Spelldata

  • id:324260
  • name:Sinful Revelation
  • tooltip:Increase damage taken by $w1% from aura caster.
  • description:
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Sinful Revelation 6.5 1.4 42.5sec 33.9sec 11.0sec 23.72% 0.00% 1.4 (1.4) 6.3

Buff Details

  • buff initial source:trapping_app
  • cooldown name:buff_sinful_revelation
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.06
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:10.0s / 311.8s
  • trigger_min/max:0.1s / 303.8s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 38.3s

Stack Uptimes

  • sinful_revelation_1:23.72%

Spelldata

  • id:324260
  • name:Sinful Revelation
  • tooltip:Increase damage taken by $w1% from aura caster.
  • description:
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Sinful Revelation 6.8 1.7 40.3sec 31.4sec 11.0sec 25.08% 0.00% 1.7 (1.7) 6.6

Buff Details

  • buff initial source:soulforge_embers
  • cooldown name:buff_sinful_revelation
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.06
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:10.0s / 242.9s
  • trigger_min/max:0.0s / 242.9s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 40.9s

Stack Uptimes

  • sinful_revelation_1:25.08%

Spelldata

  • id:324260
  • name:Sinful Revelation
  • tooltip:Increase damage taken by $w1% from aura caster.
  • description:
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Sinful Revelation 6.3 1.5 43.4sec 34.1sec 11.0sec 23.13% 0.00% 1.5 (1.5) 6.1

Buff Details

  • buff initial source:no_lego
  • cooldown name:buff_sinful_revelation
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.06
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:10.0s / 297.9s
  • trigger_min/max:0.0s / 287.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 39.5s

Stack Uptimes

  • sinful_revelation_1:23.13%

Spelldata

  • id:324260
  • name:Sinful Revelation
  • tooltip:Increase damage taken by $w1% from aura caster.
  • description:
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
Arcane Intellect

Buff Details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff Details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:15.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
bleeding

Buff Details

  • buff initial source:enemy5
  • cooldown name:buff_bleeding
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00
Chaos Brand

Buff Details

  • buff initial source:enemy5
  • cooldown name:buff_chaos_brand
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:5.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1490
  • name:Chaos Brand
  • tooltip:Magic damage taken increased by $s1%.
  • description:{$@spelldesc255260=Your damage brands the target, increasing magic damage taken by $1490s1%.}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Mortal Wounds

Buff Details

  • buff initial source:enemy5
  • cooldown name:buff_mortal_wounds
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.50
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:115804
  • name:Mortal Wounds
  • tooltip:Healing effects received reduced by $w1%.
  • description:Grievously wounds the target, reducing the effectiveness of any healing received for {$115804d=10 seconds}.
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%
Mystic Touch

Buff Details

  • buff initial source:enemy5
  • cooldown name:buff_mystic_touch
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:5.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:113746
  • name:Mystic Touch
  • tooltip:Physical damage taken increased by $w1%.
  • description:{$@spelldesc8647=Your damage weakens the target, increasing Physical damage taken by $113746s1%.}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Power Word: Fortitude

Buff Details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.$?$w2>0[ Magic damage taken reduced by $w2%.][]
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Resources

Change Start Gain/s Loss/s Overflow (Total) End (Avg) Min Max

Statistics & Data Analysis

Fight Length
enemy5 Fight Length
Count 1217
Mean 299.97
Minimum 240.10
Maximum 359.83
Spread ( max - min ) 119.74
Range [ ( max - min ) / 2 * 100% ] 19.96%
DPS
enemy5 Damage Per Second
Count 1217
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Priority Target DPS
enemy5 Priority Target Damage Per Second
Count 1217
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
DPS(e)
enemy5 Damage Per Second (Effective)
Count 1217
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Damage
enemy5 Damage
Count 1217
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
DTPS
enemy5 Damage Taken Per Second
Count 1217
Mean 16937.16
Minimum 15534.41
Maximum 18083.47
Spread ( max - min ) 2549.06
Range [ ( max - min ) / 2 * 100% ] 7.53%
Standard Deviation 449.1039
5th Percentile 16221.78
95th Percentile 17695.66
( 95th Percentile - 5th Percentile ) 1473.87
Mean Distribution
Standard Deviation 12.8736
95.00% Confidence Interval ( 16911.93 - 16962.39 )
Normalized 95.00% Confidence Interval ( 99.85% - 100.15% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 28
0.1% Error 2701
0.1 Scale Factor Error with Delta=300 1722
0.05 Scale Factor Error with Delta=300 6888
0.01 Scale Factor Error with Delta=300 172178
HPS
enemy5 Healing Per Second
Count 1217
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS(e)
enemy5 Healing Per Second (Effective)
Count 1217
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
enemy5 Heal
Count 1217
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
enemy5 Healing Taken Per Second
Count 1217
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
enemy5 Theck-Meloree Index
Count 1217
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
enemy5Theck-Meloree Index (Effective)
Count 1217
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
enemy5 Max Spike Value
Count 123
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 snapshot_stats

Stats

Level Bonus (63) Race Bonus (humanoid) Raid-Buffed Unbuffed Gear Amount
Strength 0 0 0 0 0
Agility 0 0 0 0 0
Stamina 0 0 0 0 0
Intellect 0 0 0 0 0
Spirit 0 0 0 0 0
Health 0 4136482 0
Melee Crit 5.00% 5.00% 0
Spell Crit 0.00% 0.00% 0
Haste 0.00% 0.00% 0
Versatility 0.00% 0.00% 0
Mitigation Versatility 0.00% 0.00% 0
Mastery 0.00% 0.00% 0
Armor 1071 1071 1071
Run Speed 7 0 0
Tank-Miss 3.00% 3.00% 0
Tank-Dodge 3.00% 3.00% 0
Tank-Parry 3.00% 3.00% 0
Tank-Block 3.00% 3.00% 0
Tank-Crit 0.00% 0.00% 0

Gear

Source Slot Average Item Level: 0.00

Talents

Level
15 none none none
30 none none none
45 none none none
60 none none none
75 none none none
90 none none none
100 none none none

Profile

enemy="enemy5"
source=default
spec=unknown
level=63
race=humanoid
role=tank
position=front
talents=0000000

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=snapshot_stats

# Executed every time the actor is available.


# Gear Summary
# gear_ilvl=0.00

APM

Average number of actions executed per minute.

APS

Average absorption per active player duration.

Constant Buffs

Buffs received prior to combat and present the entire fight.

Execute

Average number of times an action is executed per iteration.

Crit

Average crit damage.

Crit%

Percentage of executes that resulted in critical strikes.

DPE

Average damage per execution of an individual action.

DPET

Average damage per execute time of an individual action; the amount of damage generated, divided by the time taken to execute the action, including time spent in the GCD.

DPR

Average damage per resource point spent.

DPS

Average damage per active player duration.

DPSE

Average damage per fight duration.

DTPS

Average damage taken per second per active player duration.

HPS

Average healing (and absorption) per active player duration.

HPSE

Average healing (and absorption) per fight duration.

HPE

Average healing (or absorb) per execution of an individual action.

HPET

Average healing (or absorb) per execute time of an individual action; the amount of healing generated, divided by the time taken to execute the action, including time spent in the GCD.

HPR

Average healing (or absorb) per resource point spent.

Count

Average count of impacts per iteration.

Dodge%

Percentage of executes that resulted in dodges.

DPS%

Percentage of total DPS contributed by a particular action.

HPS%

Percentage of total HPS (including absorb) contributed by a particular action.

Theck-Meloree Index

Measure of damage smoothness, calculated over entire fight length. Related to max spike damage, 1k TMI is roughly equivalent to 1% of your health. TMI ignores external healing and absorbs. Lower is better.

TMI bin size

Time bin size used to calculate TMI and MSD, in seconds.

Type

Direct or Periodic damage.

Dynamic Buffs

Temporary buffs received during combat, perhaps multiple times.

Buff Benefit

The percentage of times the buff had a actual benefit for its mainly intended purpose, eg. damage buffed / spell executes.

Glance%

Percentage of executes that resulted in glancing blows.

Block%

Percentage of executes that resulted in blocking blows.

Id

Associated spell-id for this ability.

Ability

Name of the ability.

Total

Total damage for this ability during the fight.

Hit

Average non-crit damage.

Interval

Average time between executions of a particular action.

Avg

Average direct damage per execution.

Miss%

Percentage of executes that resulted in misses, dodges or parries.

Origin

The player profile from which the simulation script was generated. The profile must be copied into the same directory as this HTML file in order for the link to work.

Parry%

Percentage of executes that resulted in parries.

RPS In

Average primary resource points generated per second.

RPS Out

Average primary resource points consumed per second.

Scale Factors

Gain per unit stat increase except for Hit/Expertise which represent Loss per unit stat decrease.

Gear Amount

Amount from raw gear, before class, attunement, or buff modifiers. Amount from hybrid primary stats (i.e. Agility/Intellect) shown in parentheses.

Stats Raid Buffed

Amount after all static buffs have been accounted for. Dynamic buffs (i.e. trinkets, potions) not included.

Stats Unbuffed

Amount after class modifiers and effects, but before buff modifiers.

Ticks

Average number of periodic ticks per iteration. Spells that do not have a damage-over-time component will have zero ticks.

Ticks Crit

Average crit tick damage.

Ticks Crit%

Percentage of ticks that resulted in critical strikes.

Ticks Hit

Average non-crit tick damage.

Ticks Miss%

Percentage of ticks that resulted in misses, dodges or parries.

Ticks Uptime%

Percentage of total time that DoT is ticking on target.

Ticks Avg

Average damage per tick.

Timeline Distribution

The simulated encounter's duration can vary based on the health of the target and variation in the raid DPS. This chart shows how often the duration of the encounter varied by how much time.

Waiting

This is the percentage of time in which no action can be taken other than autoattacks. This can be caused by resource starvation, lockouts, and timers.

Scale Factor Ranking

This row ranks the scale factors from highest to lowest, checking whether one scale factor is higher/lower than another with statistical significance.

Uptime Average Duration

The average duration of an instance of the tracked uptime.

TMI Range

This is the range of TMI values containing 95.00% of the data, roughly centered on the mean.

TMI/MSD Window

Window length used to calculate TMI and MSD, in seconds.

Max Spike Damage

Maximum amount of net damage taken in any N-second period (default 6sec), expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Error

Estimator for the 95.00% confidence interval.

Range

This is the range of values containing 95.00% of the data, roughly centered on the mean.

Fight Length

Fight Length: 300.00
Vary Combat Length: 0.20

Fight Length is the specified average fight duration. If vary_combat_length is set, the fight length will vary by +/- that portion of the value. See Combat Length in the wiki for further details.